DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and CD2AP

DIOPT Version :10

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_036252.1 Gene:CD2AP / 23607 HGNCID:14258 Length:639 Species:Homo sapiens


Alignment Length:105 Identity:28/105 - (26%)
Similarity:44/105 - (41%) Gaps:13/105 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 QKHNNGGSLDSRYTPDPNHRGPLKIGGKGGVDIIRPRTTPTGVPGVVLKRVVVALYDYKSRDESD 113
            ::|.|..||..|.:     ...|..||      |:|......:.....||....|::|..::|.:
Human    73 ERHGNVASLVQRIS-----TYGLPAGG------IQPHPQTKNIKKKTKKRQCKVLFEYIPQNEDE 126

  Fly   114 LSFMKGDRMEVIDDTESDWWRVVNLTTRQEGLIPLNFVAE 153
            |....||.:::.::.|..||.  .....:.||.|.|||.|
Human   127 LELKVGDIIDINEEVEEGWWS--GTLNNKLGLFPSNFVKE 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH2_Src_family 158..259 CDD:199827
PTKc_Src_like 289..538 CDD:270630
SH3_Src_like 99..150 CDD:212779 12/50 (24%)
CD2APNP_036252.1 Interaction with ANLN and localization to the midbody. /evidence=ECO:0000269|PubMed:15800069 1..175 28/105 (27%)
SH3_CD2AP_1 3..58 CDD:212986
SH3_CD2AP_2 111..165 CDD:212987 17/56 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 168..209
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..256
SH3_CD2AP_3 271..327 CDD:212989
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 333..428
SH3-binding. /evidence=ECO:0000255 336..352
SH3-binding. /evidence=ECO:0000255 378..397
SH3-binding. /evidence=ECO:0000255 410..422
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.