DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and Sla

DIOPT Version :9

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:XP_017172011.1 Gene:Sla / 20491 MGIID:104295 Length:320 Species:Mus musculus


Alignment Length:302 Identity:92/302 - (30%)
Similarity:124/302 - (41%) Gaps:80/302 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 RPRTTPTGVPGVVLKRVVVALYDYKSRDESDLSFMKGDRMEVIDDTESDWWRVVNLTTRQEGLIP 147
            ||.::..|:....|    ..|.||.|.|.|...|.:|:::.||.| |..||:.::|:|.:|..||
Mouse    53 RPLSSSEGLESDFL----AVLTDYPSPDISPPIFRRGEKLRVISD-EGGWWKAISLSTGRESYIP 112

  Fly   148 LNFVAEERSVNSEDWFFENVLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSVKDWEDGRGYH 212
            ...||..    ...|.||.:.|.:|::||...:...|:|::|.||.....|||||      |...
Mouse   113 GICVARV----YHGWLFEGLGRDKAEELLQLPDTKIGSFMIRESETKKGFYSLSV------RHRQ 167

  Fly   213 VKHYRIKPLDNGGYYIATNQTFPSLQALVMAYSKENALGLCHILSRPC-------PKPQPQMWDL 270
            ||||||..|.|..|||:...||..|:.||..|| |.|.|||.:|:.||       |...|     
Mouse   168 VKHYRIFRLPNNWYYISPRLTFQCLEDLVTHYS-EVADGLCCVLTTPCLAQNIPAPTSHP----- 226

  Fly   271 GPELRDKYEIPRSEIQLLRKLGRGNFGEVFYGKWRNSIDVAVKTLREGTMSTAAFLQEAAIMKKF 335
                 .....|.|.:.|.:|        .|  .|:.     |..|:||:        |.|     
Mouse   227 -----SPCTSPGSPVTLRQK--------TF--DWKR-----VSRLQEGS--------EGA----- 258

  Fly   336 RHNRLVALYAVCSQEEPIYIVQEYMSKGSLLDFLREGDGRYL 377
                          |.|:.:.:...|.|     |||....||
Mouse   259 --------------ENPLRVDESLFSYG-----LRESIASYL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779 19/50 (38%)
SH2_Src_family 158..259 CDD:199827 42/100 (42%)
STYKc 285..537 CDD:214568 19/93 (20%)
PTKc_Src_like 289..538 CDD:270630 18/89 (20%)
SlaXP_017172011.1 SH3_SLAP 65..119 CDD:212943 22/58 (38%)
SH2_SLAP 112..209 CDD:198207 44/107 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.