DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and sel-15

DIOPT Version :9

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001366799.1 Gene:sel-15 / 175225 WormBaseID:WBGene00016030 Length:847 Species:Caenorhabditis elegans


Alignment Length:404 Identity:106/404 - (26%)
Similarity:174/404 - (43%) Gaps:79/404 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 PSEHNPNGYSLSVKD------WEDGRGYH-----VKHYRIKPLDNGGYYIATNQTFPSLQALVMA 243
            ||.:.....::|:.|      |...||:.     :|||..:.::..               :...
 Worm   421 PSSNASYNSTVSLDDQQTPVIWAYERGHDAIVALLKHYAARTVEGD---------------VCSE 470

  Fly   244 YSK-ENALGLCHILSRPCPKPQPQMWDLGPELRDK-------------YEIPRSEIQLLRKLGRG 294
            ||. |::.       .|.|.|..::..|   .|||             :.:..:||:....:|.|
 Worm   471 YSSGESSY-------TPLPSPMGRLTSL---TRDKADLLQLRSALPAPFHLCLAEIEFQESIGSG 525

  Fly   295 NFGEVFYGKWRNSIDVAVKTLRE---GTMS-TAAFLQEAAIMKKFRHNRLVALYAVCSQEEP--I 353
            :||:|:.|.:|..: ||||..|.   |..| |....:|.:|:.:..|..:|| :...|.::|  .
 Worm   526 SFGKVYKGTYRGKL-VAVKRYRAMAFGCKSETDMLCREVSILSRLAHPNVVA-FVGTSLDDPSQF 588

  Fly   354 YIVQEYMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLE---SKQLIHRDLAARNVLIGE 415
            .|:.|::..|||...|.| :.|.:.....:.|:..||.||.||.   :|.:|||||.:.|:||..
 Worm   589 AIITEFVENGSLFRLLHE-EKRVMDPAFRLRISLDVARGMRYLHESAAKPVIHRDLNSHNILIHA 652

  Fly   416 NNVAKICDFGLARVIA--DDEYCPKQGSRFPVKWTAPEAIIY-GKFSIKSDVWSYGILLMELFTY 477
            :..:.:.|||.:|.:.  :||...||...  ::|.|||.... ||:..|.||:|:.:::.|:.| 
 Worm   653 DGRSVVADFGESRFVCQREDENLTKQPGN--LRWMAPEVFSQSGKYDRKVDVFSFALVIWEIHT- 714

  Fly   478 GQVPYPGMHSREVIENIERGFRMPKPT-----NHYFPDNIYQLLLQCWDAVPEKRPTF----EFL 533
            .::|:  .|.:......|..::..:||     ...||.:|..|:.|.|......||.|    ..|
 Worm   715 AELPF--SHLKPAAAAAEMTYKRGRPTLPNQPTAQFPAHILSLIPQAWHPESSSRPDFVEIVALL 777

  Fly   534 NHYFESFSVTSEVP 547
            ..:.||.......|
 Worm   778 EPHVESTHTDISAP 791

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779
SH2_Src_family 158..259 CDD:199827 13/80 (16%)
STYKc 285..537 CDD:214568 82/272 (30%)
PTKc_Src_like 289..538 CDD:270630 81/269 (30%)
sel-15NP_001366799.1 ANKYR 3..217 CDD:223738
ANK repeat 115..147 CDD:293786
PHA03095 128..>388 CDD:222980
ANK repeat 153..180 CDD:293786
ANK repeat 182..213 CDD:293786
ANK repeat 215..246 CDD:293786
ANK repeat 285..318 CDD:293786
ANK repeat 320..353 CDD:293786
ANKYR <323..458 CDD:223738 8/36 (22%)
ANK repeat 355..380 CDD:293786
PKc_TNNI3K 522..780 CDD:270966 81/265 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X88
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.