DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and dlk-1

DIOPT Version :9

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001021443.1 Gene:dlk-1 / 173128 WormBaseID:WBGene00001008 Length:928 Species:Caenorhabditis elegans


Alignment Length:308 Identity:91/308 - (29%)
Similarity:137/308 - (44%) Gaps:49/308 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 KPQPQMWDLGPELRDKYEIPRSEIQLLRKLGRGNFGEVFYGKWRNSIDVAVKTLREGTMSTAAFL 326
            |.:.::|          |||...|..|..||.|:.|.||.|:..|. .||||.:.:        |
 Worm   122 KSEDELW----------EIPFDAISELEWLGSGSQGAVFRGQLENR-TVAVKKVNQ--------L 167

  Fly   327 QEAAI--MKKFRHNRLVALYAVCSQEEPIYIVQEYMSKGSLLDFLREGDGRYLHFEDLIYIATQV 389
            :|..|  ::..||..::....|||:.....||.||.|||.|...|:..:  .:..|.......::
 Worm   168 KETEIKHLRHLRHQNIIEFLGVCSKSPCYCIVMEYCSKGQLCTVLKSRN--TITRELFAQWVKEI 230

  Fly   390 ASGMEYLESKQLIHRDLAARNVLIGENNVAKICDFGLARVIADDE-----YCPKQGSRFPVKWTA 449
            |.||.||...::|||||.:.|:||...:..||||||.:.:....:     :|   |:   |.|.|
 Worm   231 ADGMHYLHQNKVIHRDLKSPNILISAEDSIKICDFGTSHMQKKMDSTMMSFC---GT---VSWMA 289

  Fly   450 PEAIIYGKFSIKSDVWSYGILLMELFTYGQVPYPGMHSREVIENIERG-FRMPKPTNHYFPDNIY 513
            ||.|.....:.|.||:|:|::|.|:.| .:.||..:....:|..:... ..:|.|..  .|..:.
 Worm   290 PEMIKKQPCNEKVDVYSFGVVLWEMLT-RETPYANIAQMAIIFGVGTNILSLPMPEE--APKGLV 351

  Fly   514 QLLLQCWDAVPEKRPTFEFLNHYF-----ESFSVTSEV------PYRE 550
            .|:.||.......||:|..:..::     |.|.:|.|.      .|||
 Worm   352 LLIKQCLSQKGRNRPSFSHIRQHWEIFKPELFEMTEEEWQLAWDSYRE 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779
SH2_Src_family 158..259 CDD:199827
STYKc 285..537 CDD:214568 79/259 (31%)
PTKc_Src_like 289..538 CDD:270630 77/261 (30%)
dlk-1NP_001021443.1 PKc_like 141..377 CDD:304357 77/255 (30%)
S_TKc 141..374 CDD:214567 77/252 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X88
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.