DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and Bmx

DIOPT Version :9

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_033889.2 Gene:Bmx / 12169 MGIID:1101778 Length:655 Species:Mus musculus


Alignment Length:528 Identity:186/528 - (35%)
Similarity:265/528 - (50%) Gaps:74/528 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 DPNHRGP------LKIGGKGGVDIIRPRTTPTGVPGVVLKR------VVVALYDYKSRDESDLSF 116
            |..||.|      |||          ||..|      |||.      .::..||..|:.......
Mouse   162 DEKHRAPTFPERLLKI----------PRAVP------VLKMDASSSGAILPQYDSYSKKSCGSQP 210

  Fly   117 MKGDRMEVIDDTESDWWRVVNLTTRQE---------------------GLIPLNFVAEERSVNSE 160
            ....|....:|. .|||:|..|.:.::                     |....:...||.::::.
Mouse   211 TSNIRYIPREDC-PDWWQVRKLKSEEDIACSNQLERNIASHSTSKMSWGFPESSSSEEEENLHAY 274

  Fly   161 DWFFENVLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSV--KDWEDGRGYHVKHYRIKPLDN 223
            |||..|:.|.:::: ||.::...|.|:||.|. ....|::|:  |...|.:| .||||.:.....
Mouse   275 DWFAGNISRSQSEQ-LLRQKGKEGAFMVRNSS-QMGMYTVSLFSKAVNDKKG-TVKHYHVHTNAE 336

  Fly   224 GGYYIATNQTFPSLQALVMAYSKENALGLCHILSRPC---PKPQPQMWDLGPELRDKYEIPRSEI 285
            ...|:|.|..|.|:..|: .|.:.|:.|:...|..|.   ....|....||..:   :|:.|.||
Mouse   337 NKLYLAENYCFDSIPKLI-HYHQHNSAGMITRLRHPVSTKANKVPVSVALGSGI---WELKREEI 397

  Fly   286 QLLRKLGRGNFGEVFYGKWRNSIDVAVKTLREGTMSTAAFLQEAAIMKKFRHNRLVALYAVCSQE 350
            .||::||.|.||.|..|:|:...|||||.::||.||...|.|||..|.|..|.:||..|.|||::
Mouse   398 TLLKELGNGQFGVVQLGQWKGQYDVAVKMIKEGAMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKK 462

  Fly   351 EPIYIVQEYMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLESKQLIHRDLAARNVLIGE 415
            .|||||.||::.|.||::|: ..|:.|....|:.:...|..||.:|||.|.|||||||||.|:..
Mouse   463 YPIYIVTEYITNGCLLNYLK-SHGKGLESCQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDS 526

  Fly   416 NNVAKICDFGLARVIADDEYCPKQGSRFPVKWTAPEAIIYGKFSIKSDVWSYGILLMELFTYGQV 480
            :...|:.|||:.|.:.||:|....|::|||||:|||...|.|:|.|||||::|||:.|:|:.|:.
Mouse   527 DLSVKVSDFGMTRYVLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKQ 591

  Fly   481 PYPGMHSREVIENIERGFRMPKPTNHYFPDNIYQLLLQCWDAVPEKRPTFEFLNHYFESFSVTSE 545
            ||....:.||:..:.:|.|:.:|  ....|.|||::..||..:|||||||:.|....|       
Mouse   592 PYDLYDNSEVVVKVSQGHRLYRP--QLASDTIYQIMYSCWHELPEKRPTFQQLLSAIE------- 647

  Fly   546 VPYREVQD 553
             |.|| ||
Mouse   648 -PLRE-QD 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779 11/71 (15%)
SH2_Src_family 158..259 CDD:199827 31/102 (30%)
STYKc 285..537 CDD:214568 116/251 (46%)
PTKc_Src_like 289..538 CDD:270630 113/248 (46%)
BmxNP_033889.2 PH_Btk 25..151 CDD:269944
PH 27..115 CDD:278594
SH2_Tec_Bmx 269..374 CDD:198262 32/108 (30%)
PKc_like 392..647 CDD:304357 118/257 (46%)
Pkinase_Tyr 397..646 CDD:285015 116/251 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.