Sequence 1: | NP_001286937.1 | Gene: | Src64B / 48973 | FlyBaseID: | FBgn0262733 | Length: | 553 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_006604.1 | Gene: | GRAP / 10750 | HGNCID: | 4562 | Length: | 217 | Species: | Homo sapiens |
Alignment Length: | 228 | Identity: | 55/228 - (24%) |
---|---|---|---|
Similarity: | 98/228 - (42%) | Gaps: | 60/228 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 101 VALYDYKSRDESDLSFMKGDRMEVID-DTESDWWRVVNLTTRQEGLIPLNFVAEERSVNSEDWFF 164
Fly 165 ENVLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSVKDWEDGRGYHVKHYRIKPLDNGGYYIA 229
Fly 230 TNQTFPSLQALVMAY-----SKENAL------------GLC------------------------ 253
Fly 254 HILSRPCPKPQPQMWDLGPELRDKYEIPRSEIQ 286 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Src64B | NP_001286937.1 | SH3_Src_like | 99..150 | CDD:212779 | 14/49 (29%) |
SH2_Src_family | 158..259 | CDD:199827 | 30/141 (21%) | ||
STYKc | 285..537 | CDD:214568 | 1/2 (50%) | ||
PTKc_Src_like | 289..538 | CDD:270630 | |||
GRAP | NP_006604.1 | SH3_GRAP_N | 2..55 | CDD:212881 | 15/56 (27%) |
SH2_Grb2_like | 56..150 | CDD:199828 | 27/100 (27%) | ||
SH3_GRAP_C | 162..214 | CDD:212884 | 10/57 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000006 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |