DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and grap2

DIOPT Version :9

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:XP_002933793.1 Gene:grap2 / 100492322 XenbaseID:XB-GENE-6086850 Length:301 Species:Xenopus tropicalis


Alignment Length:208 Identity:57/208 - (27%)
Similarity:107/208 - (51%) Gaps:32/208 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 ALYDYKSRDESDLSFMKGDRMEVIDDTESDWWRVVNLTTRQEGLIPLNFVAEERSVNSEDWFFEN 166
            |:|::.:..|.:|||.|||.:::: .::.:|::  :.....||.:|.|:|    .|:...|:.||
 Frog     5 AMYEFNASGEDELSFKKGDVLKIL-SSDDNWYK--SELNGSEGYVPKNYV----EV
HFPRWYCEN 62

  Fly   167 VLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSVKDWEDGRGYHVKHYRIKPLDNGGYYIATN 231
            :.|.||:.:|:...  .|.|::|.|:.:...:|:||:|.:|     |:|:::.....|.||:.| 
 Frog    63 ISRGEAESILIGRF--VGAFIIRASQTSKGEFSMSVRDEDD-----VQHFKVMRDIRGNYYLWT- 119

  Fly   232 QTFPSLQALVMAYSKENALGLCHILSRPCPKPQPQMW--DLGPELRDKYEIPRSEIQLLRKLGRG 294
            :.|.||..||..|...:       :||     |.:::  :.|.|.::|  :....::..|..|.|
 Frog   120 EKFKSLNKLVEYYKTAS-------ISR-----QKEIYLRE
EGSEAQEK--LVEKHVRDPRSSGGG 170

  Fly   295 NFGEVF-YGKWRN 306
            ..|::. .|..||
 Frog   171 RAGKLMPAGSQRN 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779 13/47 (28%)
SH2_Src_family 158..259 CDD:199827 29/100 (29%)
STYKc 285..537 CDD:214568 7/23 (30%)
PTKc_Src_like 289..538 CDD:270630 7/19 (37%)
grap2XP_002933793.1 SH3_GRAP2_N 2..53 CDD:212880 15/54 (28%)
SH2_Grb2_like 54..147 CDD:199828 31/112 (28%)
SH3_GRAP2_C 246..298 CDD:212883
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.