DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atpalpha and gda

DIOPT Version :9

Sequence 1:NP_732572.1 Gene:Atpalpha / 48971 FlyBaseID:FBgn0002921 Length:1041 Species:Drosophila melanogaster
Sequence 2:XP_004910825.1 Gene:gda / 100486841 XenbaseID:XB-GENE-987046 Length:477 Species:Xenopus tropicalis


Alignment Length:389 Identity:72/389 - (18%)
Similarity:127/389 - (32%) Gaps:113/389 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   460 ILKKEVSGDASEAALL------KCMELALGDVMNIRKRNKKIAEVPFNSTNKYQVSIHETEDT-- 516
            :|:..:.|..|...:|      |..:|||         ..|..|.......|.:..:....||  
 Frog    23 VLENHILGVGSTGKILFIEHAEKEAQLAL---------KWKFDESKIEDLGKNEFFMPGMIDTHI 78

  Fly   517 NDPRYLLVMKGAPERILERCSTIFINGKEKVLDEEM---------KEAFNN-------------- 558
            :.|:|..:..|....:|:....|....:||..|.::         :....|              
 Frog    79 HAPQYSFIGSGMDRPLLQWLEHITFPTEEKFSDLDLASNIYETVVRRTLKNGTTTACYFATIHTD 143

  Fly   559 AYMELGGLGER-----VLG-FCDFMLPSDKYPNGFKFNTDDINFPIDNLRFVGLM-----SMIDP 612
            |.:.|..:.:|     .:| .|  |..:..||...:...:.|   .:..|||..|     ..:.|
 Frog   144 ASLVLADIADRYGQRAFIGKVC--MDSNTAYPEYIESTEESI---AETQRFVEAMQNMKYDRVKP 203

  Fly   613 ---PRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKSVG--IISEGNETVEDIAQRLNIPVSE 672
               ||.||        |...:::...|       .:|.|.|  |.|..:|:|.:|.:.||:....
 Frog   204 IITPRFAV--------SCSERLLCELG-------RLADSYGLHIQSHISESVAEIQEVLNLFPEY 253

  Fly   673 VNPREA---------KAAVVHGAELRDVSSDQLDEILRYHTEIVFARTSPQQKLIIVEGCQRMGA 728
            .|..|.         ...:.||..|.|      :|:..:.:........|...:.:..|...:..
 Frog   254 NNYTEVYSKNKLLTNMTVMAHGCYLTD------EELHLFRSNGSAISHCPNSNISLCSGHLDVSN 312

  Fly   729 IVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKK 792
            ::.            :|..:|:...|||      ...:.:||    :|...:|..:::|...:|
 Frog   313 VIK------------QKVKVGLGTDIAG------GYSISMLD----AIRKAIETSKILFMEREK 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AtpalphaNP_732572.1 ATPase-IIC_X-K 45..1041 CDD:273445 72/389 (19%)
Cation_ATPase_N 58..132 CDD:214842
E1-E2_ATPase 152..383 CDD:278548
Cation_ATPase 445..539 CDD:289987 17/86 (20%)
COG4087 <695..770 CDD:226572 8/74 (11%)
Cation_ATPase_C 817..1025 CDD:279079
gdaXP_004910825.1 metallo-dependent_hydrolases 8..467 CDD:381920 72/389 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43294
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.