DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NRAS and nras

DIOPT Version :9

Sequence 1:NP_002515.1 Gene:NRAS / 4893 HGNCID:7989 Length:189 Species:Homo sapiens
Sequence 2:NP_001016763.1 Gene:nras / 549517 XenbaseID:XB-GENE-6085898 Length:189 Species:Xenopus tropicalis


Alignment Length:189 Identity:175/189 - (92%)
Similarity:182/189 - (96%) Gaps:0/189 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog     1 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 65

Human    66 AMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQA 130
            |||||||||||||||||||||||||||||.||||||||||||||||||||||||||:||||||||
 Frog    66 AMRDQYMRTGEGFLCVFAINNSKSFADINAYREQIKRVKDSDDVPMVLVGNKCDLPSRTVDTKQA 130

Human   131 HELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM 189
            .|||:||||||||||||||||||||||||||||.|||||||:||:|..|||:.:||.:|
 Frog   131 QELARSYGIPFIETSAKTRQGVEDAFYTLVREIHQYRMKKLDSSEDNNQGCIRIPCKLM 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NRASNP_002515.1 H_N_K_Ras_like 3..164 CDD:133338 156/160 (98%)
Effector region 32..40 7/7 (100%)
Hypervariable region 166..185 12/18 (67%)
nrasNP_001016763.1 H_N_K_Ras_like 3..163 CDD:133338 155/159 (97%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H55661
Inparanoid 00.000 Not matched by this tool.
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10604
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.