DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NRAS and ras1

DIOPT Version :9

Sequence 1:NP_002515.1 Gene:NRAS / 4893 HGNCID:7989 Length:189 Species:Homo sapiens
Sequence 2:NP_593579.1 Gene:ras1 / 2542285 PomBaseID:SPAC17H9.09c Length:219 Species:Schizosaccharomyces pombe


Alignment Length:180 Identity:115/180 - (63%)
Similarity:135/180 - (75%) Gaps:5/180 - (2%)


- Green bases have known domain annotations that are detailed below.


Human     1 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 65
            :.||||||||.||||||||||||||:||||||||||||||||:..||||..|||:||||||||||
pombe     6 LREYKLVVVGDGGVGKSALTIQLIQSHFVDEYDPTIEDSYRKKCEIDGEGALLDVLDTAGQEEYS 70

Human    66 AMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPT-RTVDTKQ 129
            |||:||||||||||.|:.|.:..||.:|:.:.:||.||||.|..|:|||.|||||.. |.|...:
pombe    71 AMREQYMRTGEGFLLVYNITSRSSFDEISTFYQQILRVKDKDTFPVVLVANKCDLEAERVVSRAE 135

Human   130 AHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQ 179
            ..:||||....::|||||.|..||:|||:|||.||:|.    .|.:.|.|
pombe   136 GEQLAKSMHCLYVETSAKLRLNVEEAFYSLVRTIRRYN----KSEEKGFQ 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NRASNP_002515.1 H_N_K_Ras_like 3..164 CDD:133338 109/161 (68%)
Effector region 32..40 7/7 (100%)
Hypervariable region 166..185 4/14 (29%)
ras1NP_593579.1 small_GTPase 7..172 CDD:197466 111/164 (68%)
H_N_K_Ras_like 8..170 CDD:133338 109/161 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100217
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.670

Return to query results.
Submit another query.