DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NRAS and Nras

DIOPT Version :9

Sequence 1:NP_002515.1 Gene:NRAS / 4893 HGNCID:7989 Length:189 Species:Homo sapiens
Sequence 2:XP_006501181.1 Gene:Nras / 18176 MGIID:97376 Length:220 Species:Mus musculus


Alignment Length:189 Identity:188/189 - (99%)
Similarity:189/189 - (100%) Gaps:0/189 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse    32 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 96

Human    66 AMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQA 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse    97 AMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQA 161

Human   131 HELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM 189
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||:|
Mouse   162 HELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVLM 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NRASNP_002515.1 H_N_K_Ras_like 3..164 CDD:133338 160/160 (100%)
Effector region 32..40 7/7 (100%)
Hypervariable region 166..185 18/18 (100%)
NrasXP_006501181.1 H_N_K_Ras_like 34..195 CDD:133338 160/160 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83967440
Domainoid 1 1.000 321 1.000 Domainoid score I15031
eggNOG 1 0.900 - - E2759_KOG0395
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H55661
Inparanoid 1 1.050 377 1.000 Inparanoid score I14019
Isobase 00.000 Not matched by this tool.
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 1 1.000 - - oto126176
orthoMCL 1 0.900 - - OOG6_100217
Panther 1 1.100 - - LDO PTHR24070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10604
SonicParanoid 1 1.000 - - X934
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1717.290

Return to query results.
Submit another query.