DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)73Ah and PCGF6

DIOPT Version :9

Sequence 1:NP_001246797.1 Gene:l(3)73Ah / 48903 FlyBaseID:FBgn0002283 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001011663.1 Gene:PCGF6 / 84108 HGNCID:21156 Length:350 Species:Homo sapiens


Alignment Length:209 Identity:87/209 - (41%)
Similarity:128/209 - (61%) Gaps:20/209 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ERRVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTCDNIIHQSHPLQY 66
            ||.:.|..:.|:|.|.||.||.|||||:|||||||||||:|:|......||.|:.::||:.||..
Human   120 ERLINLSELTPYILCSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQPLYN 184

  Fly    67 ISFDRTMQDIVYKLVPKLQEDESRRERDFYKSRNMPCPKDI----TQNHEDDNEKVMDAHAESDF 127
            |..||.:||||||||..|:|.|.::..||||.|.:..||..    ..:.:..::||:    ||.|
Human   185 IRLDRQLQDIVYKLVINLEEREKKQMHDFYKERGLEVPKPAVPQPVPSSKGRSKKVL----ESVF 245

  Fly   128 H---RLDEQVNVCLECISNN-----FKNLQRRFIRCSSQATITHLKKLVAKKILNGIEKYREIDI 184
            .   .||  :::.||.|..|     ||.|:::|:|.|.:|||.|::|.:.:|:  |::...::||
Human   246 RIPPELD--MSLLLEFIGANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKM--GLDPACQVDI 306

  Fly   185 LCNEELLGKDHTLK 198
            :|.:.||.:..||:
Human   307 ICGDHLLEQYQTLR 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)73AhNP_001246797.1 RING-HC_PCGF3 13..59 CDD:319649 27/45 (60%)
RAWUL_PCGF3 133..217 CDD:340603 24/71 (34%)
PCGF6NP_001011663.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115
zf-C3HC4 134..172 CDD:278524 25/37 (68%)
RAWUL 270..>319 CDD:292824 17/50 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203951at2759
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.