DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)73Ah and AT3G23060

DIOPT Version :9

Sequence 1:NP_001246797.1 Gene:l(3)73Ah / 48903 FlyBaseID:FBgn0002283 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_188946.2 Gene:AT3G23060 / 821880 AraportID:AT3G23060 Length:480 Species:Arabidopsis thaliana


Alignment Length:115 Identity:40/115 - (34%)
Similarity:58/115 - (50%) Gaps:20/115 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERRVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCL-VKHLEEK-KTCPTCDNIIHQSHP 63
            |..:|..|.:.|.:.|.||...|.||||::|||||||:||: .|.:.|: ..||.| |:.....|
plant     1 MLTKVLSKEVKPCLACPICTNPFKDATTISECLHTFCRSCIRNKFINERVNACPVC-NVNLGVFP 64

  Fly    64 LQYISFDRTMQDIVYKLVPKLQED--------------ESRRERDFYKSR 99
            |:.:..|.|.||:..|:...:.|.              .|:::|   |||
plant    65 LEKLRSDCTWQDLKLKIYRAMMESLKKAGPKTVAASVKSSKKKR---KSR 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)73AhNP_001246797.1 RING-HC_PCGF3 13..59 CDD:319649 23/47 (49%)
RAWUL_PCGF3 133..217 CDD:340603
AT3G23060NP_188946.2 RING_Ubox 14..57 CDD:418438 22/43 (51%)
RING-HC finger (C3HC4-type) 16..56 CDD:319361 21/39 (54%)
RAWUL_DRIP_like 364..467 CDD:340607
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4257
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X607
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.