DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)73Ah and DRIP2

DIOPT Version :9

Sequence 1:NP_001246797.1 Gene:l(3)73Ah / 48903 FlyBaseID:FBgn0002283 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001323803.1 Gene:DRIP2 / 817608 AraportID:AT2G30580 Length:420 Species:Arabidopsis thaliana


Alignment Length:208 Identity:56/208 - (26%)
Similarity:87/208 - (41%) Gaps:48/208 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERRVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHL--EEKKTCPTCDNIIHQSHP 63
            |..:||.:|:...:||.:|.....||||::|||||||:.|:.:.:  :|.::||.|| |.....|
plant     5 MVAKVKRETVVACMTCPLCDKLLRDATTISECLHTFCRKCIYEKITEDEIESCPVCD-IDLGGTP 68

  Fly    64 LQYISFDRTMQDIVYKLVPKLQEDESRRERDFYKSRNMPCPKDITQNHEDDNEKVMDAHAESDFH 128
            |:.:..|..:||:..||.|..::.|  |..:...|.::|..:         .|:.:.:...|. .
plant    69 LEKLRPDHILQDLRAKLFPLKRKKE--RAPEVVSSISLPAKR---------KERSISSLVVST-P 121

  Fly   129 RLDEQVNVCLECISNNFKNLQRRFIRCSSQATITHLKKLVAKKILNGIEKYREIDILCNEELLGK 193
            |:..|...    .....|...|:.:|.|...|...:||                     ||..|.
plant   122 RVSAQAGT----TGKRTKAATRKDVRGSGSFTKRTVKK---------------------EEEFGD 161

  Fly   194 DH--------TLK 198
            ||        |||
plant   162 DHVESASSPETLK 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)73AhNP_001246797.1 RING-HC_PCGF3 13..59 CDD:319649 21/47 (45%)
RAWUL_PCGF3 133..217 CDD:340603 16/74 (22%)
DRIP2NP_001323803.1 RING_Ubox 19..61 CDD:418438 18/41 (44%)
RAWUL_DRIP_like 310..412 CDD:340607
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4257
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 1 1.000 - - oto3630
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X607
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.