DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)73Ah and PCGF2

DIOPT Version :9

Sequence 1:NP_001246797.1 Gene:l(3)73Ah / 48903 FlyBaseID:FBgn0002283 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001356543.1 Gene:PCGF2 / 7703 HGNCID:12929 Length:344 Species:Homo sapiens


Alignment Length:233 Identity:89/233 - (38%)
Similarity:139/233 - (59%) Gaps:29/233 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTCDNIIHQSHPLQYIS 68
            |:|:..:|||:.|.:||||||||||:.||||:|||:|:|::||..|.||.||..:|::.||..|.
Human     6 RIKITELNPHLMCALCGGYFIDATTIVECLHSFCKTCIVRYLETNKYCPMCDVQVHKTRPLLSIR 70

  Fly    69 FDRTMQDIVYKLVPKLQEDESRRERDFYKSRNMPCPKDITQNHEDDNEKVMDAH--AESDFHRLD 131
            .|:|:|||||||||.|.:||.:|.||||.:..:   .::.....:|..:|::..  |.||    |
Human    71 SDKTLQDIVYKLVPGLFKDEMKRRRDFYAAYPL---TEVPNGSNEDRGEVLEQEKGALSD----D 128

  Fly   132 EQVNVCLEC-------------ISNNFKNLQR---RFIRCSSQATITHLKKLVAKKILNGIEKYR 180
            |.|::.:|.             :.|...:.::   ||:||.:..|:.||.|.:..| ::...||:
Human   129 EIVSLSIEFYEGARDRDEKKGPLENGDGDKEKTGVRFLRCPAAMTVMHLAKFLRNK-MDVPSKYK 192

  Fly   181 EIDILCNEELLGKDHTL-KFVYVTRWRFRDPPLRLQFR 217
             :::|..:|.|.:.:|| ...|:..|| |:.||.|::|
Human   193 -VEVLYEDEPLKEYYTLMDIAYIYPWR-RNGPLPLKYR 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)73AhNP_001246797.1 RING-HC_PCGF3 13..59 CDD:319649 28/45 (62%)
RAWUL_PCGF3 133..217 CDD:340603 26/100 (26%)
PCGF2NP_001356543.1 RING-HC_PCGF4 12..65 CDD:319650 31/52 (60%)
RING-HC finger (C3HC4-type) 18..56 CDD:319650 25/37 (68%)
Nuclear localization signal. /evidence=ECO:0000255 81..95 8/13 (62%)
RAWUL_PCGF2 130..228 CDD:340684 26/100 (26%)
PLN02217 <236..328 CDD:215130
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..344
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.