DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)73Ah and Pcgf5

DIOPT Version :9

Sequence 1:NP_001246797.1 Gene:l(3)73Ah / 48903 FlyBaseID:FBgn0002283 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001355619.1 Gene:Pcgf5 / 76073 MGIID:1923505 Length:256 Species:Mus musculus


Alignment Length:259 Identity:102/259 - (39%)
Similarity:157/259 - (60%) Gaps:47/259 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ERRVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTCDNIIHQSHPLQY 66
            :|:..:|..||:|||.||.||.|..||||||||||||:|:|:|.|:...||.|.|.:|:::||:.
Mouse     4 QRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRCGNQVHETNPLEM 68

  Fly    67 ISFDRTMQDIVYKLVPKLQEDESRRERDFYKSRNMPCPKDITQNHEDDNEKVMDAHA-------- 123
            :..|.|:::|::||||.|:|.|.:||.:|:| :|.|     .:|.:||..||..:.|        
Mouse    69 LRLDNTLEEIIFKLVPGLREQELQRELEFWK-KNKP-----QENGQDDISKVDKSKADEEGDENQ 127

  Fly   124 -ESDFHRLDEQVNVCLECISNN-------FKNLQRRFIRCSSQATITHLKKLVAKKILNGIEKYR 180
             :.|:||.|.|:.:||:|:.||       .|.|.::|||||::.|:..:||.::.|:  .:....
Mouse   128 DDKDYHRSDPQIAICLDCLRNNGQSGDNVVKGLMKKFIRCSTRVTVGTIKKFLSLKL--KLPSSY 190

  Fly   181 EIDILCNEELLGKDHTLKFVYVTRWRFRDP-----------------------PLRLQFRPRVE 221
            |:|:|||.|::|||||::|:|:||||.|..                       |:.||:|||::
Mouse   191 ELDVLCNGEIMGKDHTMEFIYMTRWRLRGENLCCLNCSASQVCSQDGTLYQSYPMVLQYRPRID 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)73AhNP_001246797.1 RING-HC_PCGF3 13..59 CDD:319649 28/45 (62%)
RAWUL_PCGF3 133..217 CDD:340603 38/113 (34%)
Pcgf5NP_001355619.1 rad18 8..>135 CDD:273165 58/132 (44%)
RING-HC_PCGF5 16..57 CDD:319651 26/40 (65%)
RING-HC finger (C3HC4-type) 18..56 CDD:319651 24/37 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 102..133 8/35 (23%)
RAWUL_PCGF5 136..256 CDD:340604 42/121 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203951at2759
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X607
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.