DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)73Ah and Pcgf1

DIOPT Version :10

Sequence 1:NP_524933.1 Gene:l(3)73Ah / 48903 FlyBaseID:FBgn0002283 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_932109.2 Gene:Pcgf1 / 69837 MGIID:1917087 Length:259 Species:Mus musculus


Alignment Length:228 Identity:92/228 - (40%)
Similarity:145/228 - (63%) Gaps:21/228 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ERRVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTCDNIIHQSHPLQY 66
            |.|||:|.:|.||.|.:|.|||:||||:|||||||||||:||:|:..|.||.|:..||::.||..
Mouse    33 EVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLN 97

  Fly    67 ISFDRTMQDIVYKLVPKLQEDESRRERDFYKSRNMPCPKDITQNHEDDNEKVMDA--------HA 123
            :..||.||||||||||.||:.|.:|.|:||:||.:    |.......:...:.:.        |:
Mouse    98 LKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGL----DRVSQPSGEEPALSNLGLPFSSFDHS 158

  Fly   124 ESDFHRLDEQVNVCLECISN----NFKNLQRRFIRCSSQATITHLKKLVAKKI-LNGIEKYREID 183
            ::.::|.|||:::|||.:|:    |...||.:::|||.:|.:.||::::..:: ||.    :.:.
Mouse   159 KAHYYRYDEQLSLCLERLSSGKDKNKNVLQNKYVRCSVRAEVRHLRRVLCHRLMLNP----QHVQ 219

  Fly   184 ILCNEELLGKDHTLKFVYVTRWRFRDPPLRLQF 216
            :|.:.|:|....|:|.::::||..:..||.||:
Mouse   220 LLFDNEVLPDHMTMKQLWLSRWFGKPSPLLLQY 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)73AhNP_524933.1 RING_Ubox 4..96 CDD:473075 55/91 (60%)
RAWUL_PCGF3 133..217 CDD:340603 27/89 (30%)
Pcgf1NP_932109.2 RING-HC_PCGF1 36..106 CDD:438391 40/69 (58%)
Necessary for repressor activity. /evidence=ECO:0000250 86..247 53/168 (32%)
Required for the interaction with the KDM2B-SKP1 heterodimeric complex. /evidence=ECO:0000250|UniProtKB:Q9BSM1 150..255 31/107 (29%)
RAWUL_PCGF1 166..253 CDD:340601 29/91 (32%)
RING-finger and WD40-associated ubiquitin-like domain (RAWUL), sufficient for interaction with BCOR and BCORL1. /evidence=ECO:0000250|UniProtKB:Q9BSM1 167..255 28/90 (31%)

Return to query results.
Submit another query.