DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)73Ah and Pcgf1

DIOPT Version :9

Sequence 1:NP_001246797.1 Gene:l(3)73Ah / 48903 FlyBaseID:FBgn0002283 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_932109.1 Gene:Pcgf1 / 69837 MGIID:1917087 Length:247 Species:Mus musculus


Alignment Length:228 Identity:92/228 - (40%)
Similarity:145/228 - (63%) Gaps:21/228 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ERRVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTCDNIIHQSHPLQY 66
            |.|||:|.:|.||.|.:|.|||:||||:|||||||||||:||:|:..|.||.|:..||::.||..
Mouse    21 EVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLN 85

  Fly    67 ISFDRTMQDIVYKLVPKLQEDESRRERDFYKSRNMPCPKDITQNHEDDNEKVMDA--------HA 123
            :..||.||||||||||.||:.|.:|.|:||:||.:    |.......:...:.:.        |:
Mouse    86 LKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGL----DRVSQPSGEEPALSNLGLPFSSFDHS 146

  Fly   124 ESDFHRLDEQVNVCLECISN----NFKNLQRRFIRCSSQATITHLKKLVAKKI-LNGIEKYREID 183
            ::.::|.|||:::|||.:|:    |...||.:::|||.:|.:.||::::..:: ||.    :.:.
Mouse   147 KAHYYRYDEQLSLCLERLSSGKDKNKNVLQNKYVRCSVRAEVRHLRRVLCHRLMLNP----QHVQ 207

  Fly   184 ILCNEELLGKDHTLKFVYVTRWRFRDPPLRLQF 216
            :|.:.|:|....|:|.::::||..:..||.||:
Mouse   208 LLFDNEVLPDHMTMKQLWLSRWFGKPSPLLLQY 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)73AhNP_001246797.1 RING-HC_PCGF3 13..59 CDD:319649 29/45 (64%)
RAWUL_PCGF3 133..217 CDD:340603 27/89 (30%)
Pcgf1NP_932109.1 zf-C3HC4 35..73 CDD:278524 26/37 (70%)
RAWUL 165..241 CDD:292824 23/80 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203951at2759
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X607
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.