DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)73Ah and Pcgf3

DIOPT Version :9

Sequence 1:NP_001246797.1 Gene:l(3)73Ah / 48903 FlyBaseID:FBgn0002283 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001363929.1 Gene:Pcgf3 / 69587 MGIID:1916837 Length:259 Species:Mus musculus


Alignment Length:227 Identity:132/227 - (58%)
Similarity:163/227 - (71%) Gaps:21/227 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERRVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTCDNIIHQSHPLQ 65
            :.|::||..||.||||::|.||.||||||||||||||:|||||:|||..|||||..:||||||||
Mouse     2 LTRKIKLWDINAHITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRIVIHQSHPLQ 66

  Fly    66 YISFDRTMQDIVYKLVPKLQEDESRRERDFYKSRNMPCPKDI------------TQNHE---DDN 115
            ||..|||||||||||||.|||.|.|::|:||....|..|.||            .:|.|   |||
Mouse    67 YIGHDRTMQDIVYKLVPGLQEAEMRKQREFYHKLGMEVPGDIKGEACSAKQHLDPRNGETKADDN 131

  Fly   116 EKVMDA----HAESDFHRLDEQVNVCLECISNNFKNLQRRFIRCSSQATITHLKKLVAKKILNGI 176
            .....|    ..::|:||.||||::||||.|:..:.|:|::||||:|||:.||||.:|||:  .:
Mouse   132 SNKETAEEKQEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFIAKKL--NL 194

  Fly   177 EKYREIDILCNEELLGKDHTLKFVYVTRWRFR 208
            ..:.|:|||||||:||||||||||.||||||:
Mouse   195 SSFNELDILCNEEILGKDHTLKFVVVTRWRFK 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)73AhNP_001246797.1 RING-HC_PCGF3 13..59 CDD:319649 34/45 (76%)
RAWUL_PCGF3 133..217 CDD:340603 47/76 (62%)
Pcgf3NP_001363929.1 RING-HC_PCGF3 14..60 CDD:319649 34/45 (76%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..148 7/32 (22%)
RAWUL_PCGF3 153..226 CDD:340603 46/74 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850175
Domainoid 1 1.000 99 1.000 Domainoid score I7125
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4605
Inparanoid 1 1.050 283 1.000 Inparanoid score I2859
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48635
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 1 1.000 - - oto94057
orthoMCL 1 0.900 - - OOG6_107223
Panther 1 1.100 - - LDO PTHR45893
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3764
SonicParanoid 1 1.000 - - X607
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.