DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)73Ah and Pcgf5

DIOPT Version :9

Sequence 1:NP_001246797.1 Gene:l(3)73Ah / 48903 FlyBaseID:FBgn0002283 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_017445196.1 Gene:Pcgf5 / 681178 RGDID:1583513 Length:253 Species:Rattus norvegicus


Alignment Length:223 Identity:94/223 - (42%)
Similarity:147/223 - (65%) Gaps:24/223 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ERRVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTCDNIIHQSHPLQY 66
            :|:..:|..||:|||.||.||.|..||||||||||||:|:|:|.|:...||.|.|.:|:::||:.
  Rat     4 QRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRCGNQVHETNPLEM 68

  Fly    67 ISFDRTMQDIVYKLVPKLQEDESRRERDFYKSRNMPCPKDITQNHEDDNEKVMDAHA-------- 123
            :..|.|:::|::||||.|:|.|.:||.:|:| :|.|     .:|.:|:..||..:.|        
  Rat    69 LRLDNTLEEIIFKLVPGLREQELQRELEFWK-KNKP-----QENGQDEVSKVDKSKADEEGDENQ 127

  Fly   124 -ESDFHRLDEQVNVCLECISNN-------FKNLQRRFIRCSSQATITHLKKLVAKKILNGIEKYR 180
             :.|:||.|.|:.:||:|:.|:       .|.|.::|||||::.|:..:||.::.|:  .:....
  Rat   128 DDKDYHRSDPQIAICLDCLRNHGQSGDNVVKGLMKKFIRCSTRVTVGTIKKFLSLKL--KLPSSY 190

  Fly   181 EIDILCNEELLGKDHTLKFVYVTRWRFR 208
            |:|:|||.|::|||||::|:|:||||.|
  Rat   191 ELDVLCNGEIMGKDHTMEFIYMTRWRLR 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)73AhNP_001246797.1 RING-HC_PCGF3 13..59 CDD:319649 28/45 (62%)
RAWUL_PCGF3 133..217 CDD:340603 34/83 (41%)
Pcgf5XP_017445196.1 zf-C3HC4 18..56 CDD:278524 24/37 (65%)
RAWUL 154..216 CDD:292824 26/63 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203951at2759
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X607
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.