DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)73Ah and BMI1

DIOPT Version :9

Sequence 1:NP_001246797.1 Gene:l(3)73Ah / 48903 FlyBaseID:FBgn0002283 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_005171.4 Gene:BMI1 / 648 HGNCID:1066 Length:326 Species:Homo sapiens


Alignment Length:230 Identity:93/230 - (40%)
Similarity:136/230 - (59%) Gaps:21/230 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTCDNIIHQSHPLQYIS 68
            |:|:..:|||:.|.:||||||||||:.||||:|||:|:|::||..|.||.||..:|::.||..|.
Human     6 RIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIR 70

  Fly    69 FDRTMQDIVYKLVPKLQEDESRRERDFYKSRNMPCPKDITQNHED-----DNEK--VMDAHAES- 125
            .|:|:|||||||||.|.::|.:|.||||.:.  |.......::||     |.:|  :.|....| 
Human    71 SDKTLQDIVYKLVPGLFKNEMKRRRDFYAAH--PSADAANGSNEDRGEVADEDKRIITDDEIISL 133

  Fly   126 -----DFHRLDEQVNVCLECISNNFKNLQRRFIRCSSQATITHLKKLVAKKILNGIEKYREIDIL 185
                 |.:|||.:||...|.......:  :|::||.:..|:.||:|.:..|:  .|....:||::
Human   134 SIEFFDQNRLDRKVNKDKEKSKEEVND--KRYLRCPAAMTVMHLRKFLRSKM--DIPNTFQIDVM 194

  Fly   186 CNEELLGKDHTL-KFVYVTRWRFRDPPLRLQFRPR 219
            ..||.|...:|| ...|:..|| |:.||.|::|.|
Human   195 YEEEPLKDYYTLMDIAYIYTWR-RNGPLPLKYRVR 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)73AhNP_001246797.1 RING-HC_PCGF3 13..59 CDD:319649 28/45 (62%)
RAWUL_PCGF3 133..217 CDD:340603 26/84 (31%)
BMI1NP_005171.4 RING-HC_PCGF4 12..65 CDD:319650 31/52 (60%)
Nuclear localization signal. /evidence=ECO:0000255 81..95 7/13 (54%)
RAWUL_PCGF4 130..226 CDD:340685 31/100 (31%)
Interaction with PHC2. /evidence=ECO:0000269|PubMed:27827373 162..182 7/19 (37%)
Interaction with E4F1. /evidence=ECO:0000269|PubMed:16882984 164..228 23/66 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..326
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S517
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.