DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)73Ah and pcgf2

DIOPT Version :9

Sequence 1:NP_001246797.1 Gene:l(3)73Ah / 48903 FlyBaseID:FBgn0002283 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001025573.1 Gene:pcgf2 / 594961 XenbaseID:XB-GENE-1013680 Length:317 Species:Xenopus tropicalis


Alignment Length:230 Identity:92/230 - (40%)
Similarity:135/230 - (58%) Gaps:27/230 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTCDNIIHQSHPLQYIS 68
            |:|:..:|||:.|.:||||||||.|:.||||:|||:|::::||..|.||.||:.:|:..||..|.
 Frog     6 RIKMTELNPHLMCALCGGYFIDAATIVECLHSFCKTCILRYLEAHKFCPMCDSQVHKGRPLLSIR 70

  Fly    69 FDRTMQDIVYKLVPKLQEDESRRERDFYKSRNMPCPKDITQNHEDDNEKVMDAHAESDFHRLDEQ 133
            .|:|:|||||||||.|..||.:|.||||.|.:.  .||  .:..:..:||::| .|:.   :.|:
 Frog    71 SDKTLQDIVYKLVPGLFRDEMKRRRDFYASYSR--SKD--SSSAEQGQKVLEA-GEAP---VQEE 127

  Fly   134 VNVCL-----ECISNNFKNL----------QRRFIRCSSQATITHLKKLVAKKILNGIEKYREID 183
            .|:.|     |...:..::|          ..||:||.:..|||||.|.:..| ::...||: ::
 Frog   128 ENISLSIQFSEDARDEIQDLVDSEDLEKRNSLRFLRCPAAMTITHLAKFLRNK-MDVPSKYK-VE 190

  Fly   184 ILCNEELLGKDHTL-KFVYVTRWRFRDPPLRLQFR 217
            ||..||.|...:|| ...|:..|. |..||.|::|
 Frog   191 ILYEEEPLKDYYTLMDIAYIYPWG-RTGPLPLKYR 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)73AhNP_001246797.1 RING-HC_PCGF3 13..59 CDD:319649 26/45 (58%)
RAWUL_PCGF3 133..217 CDD:340603 30/99 (30%)
pcgf2NP_001025573.1 RAD18 9..>166 CDD:333230 67/164 (41%)
RING-HC_PCGF4 12..65 CDD:319650 29/52 (56%)
RING-HC finger (C3HC4-type) 18..56 CDD:319650 23/37 (62%)
RAWUL 160..224 CDD:318447 26/66 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X607
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.