DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)73Ah and pcgf5a

DIOPT Version :9

Sequence 1:NP_001246797.1 Gene:l(3)73Ah / 48903 FlyBaseID:FBgn0002283 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001122184.1 Gene:pcgf5a / 562327 ZFINID:ZDB-GENE-080723-33 Length:234 Species:Danio rerio


Alignment Length:236 Identity:95/236 - (40%)
Similarity:147/236 - (62%) Gaps:25/236 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RRVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTCDNIIHQSHPLQYI 67
            |:..::..|.:|||.||.||.|..|.||||||||||||:|:|.||...||.|...:|:::||:.:
Zfish     5 RKHLVRDFNRYITCSICRGYLIKPTAVTECLHTFCKSCIVQHFEESNECPECGIQVHETNPLEML 69

  Fly    68 SFDRTMQDIVYKLVPKLQEDESRRERDFYKSRNM-------PCPKDITQNHEDDNEKVMDAHAES 125
            ..|:|:::|::||||.|:|.|..:|.:|::...:       |..|....:.|||     |.:. .
Zfish    70 RLDKTLEEIIFKLVPGLREKEEHQESEFWRKHKIKSNGEDGPRAKKSRLSGEDD-----DGNG-G 128

  Fly   126 DFHRLDEQVNVCLECISNN-------FKNLQRRFIRCSSQATITHLKKLVAKKILNGIEKYREID 183
            |:||.|.|:.:||:|:.||       .|.|.::|||||::.|:..:||.:..|:  .:....|:|
Zfish   129 DYHRSDPQIAICLDCLRNNGQSGESIVKGLMKKFIRCSTRVTVGTIKKFLCVKL--KLPSSYELD 191

  Fly   184 ILCNEELLGKDHTLKFVYVTRWRFRDP---PLRLQFRPRVE 221
            :|||.|::||||||:|:|.||||.:..   |:.|::|||::
Zfish   192 VLCNGEIMGKDHTLEFIYRTRWRLQGDSAYPMVLEYRPRID 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)73AhNP_001246797.1 RING-HC_PCGF3 13..59 CDD:319649 28/45 (62%)
RAWUL_PCGF3 133..217 CDD:340603 37/93 (40%)
pcgf5aNP_001122184.1 zf-C3HC4 18..56 CDD:278524 25/37 (68%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 97..130 7/38 (18%)
RAWUL 155..228 CDD:292824 31/74 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 68 1.000 Domainoid score I9708
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 198 1.000 Inparanoid score I3772
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203951at2759
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 1 1.000 - - otm26311
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3764
SonicParanoid 1 1.000 - - X607
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.