DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)73Ah and btr31

DIOPT Version :9

Sequence 1:NP_001246797.1 Gene:l(3)73Ah / 48903 FlyBaseID:FBgn0002283 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001373399.1 Gene:btr31 / 555877 ZFINID:ZDB-GENE-090512-3 Length:342 Species:Danio rerio


Alignment Length:235 Identity:50/235 - (21%)
Similarity:79/235 - (33%) Gaps:81/235 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 INPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKT--CPTC------------------ 54
            :|..:.|.||...|.|..| |.|.|.||::||.::.....|  ||.|                  
Zfish     7 LNEELQCSICLDVFTDPVT-TPCGHNFCRTCLDQYWTNTHTCCCPICKEKFSKQPDLKVNIALRE 70

  Fly    55 --DNIIHQSHPLQYISFDRTMQDIVYKLVPKLQEDESRRERDFYK----SRN------------- 100
              :::..:|.|.:   .::||:|.:.|:      .|.....|..|    ||:             
Zfish    71 VVEHLKQESRPAE---SEQTMEDRLKKI------QEINHSEDPNKTAAVSRSLLLPFQTLHMSNW 126

  Fly   101 ----------------MPCPKDI----TQNHEDDNEKVMDAHAESDFHRL-DEQVNVCLECISNN 144
                            ||.|.:|    .|.|..|  ..:|....:.|..| |::..|.|..|..|
Zfish   127 MLASLVVLLAVLLLFIMPAPHNIRLELVQKHAVD--VTLDHDTANPFLILSDDEKQVSLGHIERN 189

  Fly   145 FKNLQRRFIRCSSQATITHLKKLVAKKILNGIEKYREIDI 184
            ......||         .|...::.|:..:..:.|.|:.:
Zfish   190 VPENPERF---------NHTVSVLGKQGFSSGKFYYEVQV 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)73AhNP_001246797.1 RING-HC_PCGF3 13..59 CDD:319649 17/67 (25%)
RAWUL_PCGF3 133..217 CDD:340603 10/52 (19%)
btr31NP_001373399.1 COG5222 <8..117 CDD:227547 29/118 (25%)
RING_Ubox 10..53 CDD:418438 16/43 (37%)
RING-HC finger (C3HC4-type) 13..52 CDD:319361 16/39 (41%)
SPRY_PRY_C-I_1 160..334 CDD:293968 15/72 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.