DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)73Ah and pcgf6

DIOPT Version :9

Sequence 1:NP_001246797.1 Gene:l(3)73Ah / 48903 FlyBaseID:FBgn0002283 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001082838.1 Gene:pcgf6 / 555238 ZFINID:ZDB-GENE-060526-178 Length:277 Species:Danio rerio


Alignment Length:234 Identity:83/234 - (35%)
Similarity:131/234 - (55%) Gaps:28/234 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ERRVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTCDNIIHQSHPLQY 66
            |..:.|:...|:|.|.:|.|:||||||:|||||||||||:|||......||.|..::||:.||..
Zfish    46 EPSLPLRDFYPYIRCALCNGFFIDATTITECLHTFCKSCIVKHFFYSNRCPNCSIVVHQTQPLYC 110

  Fly    67 ISFDRTMQDIVYKLVPKLQEDESRRERDFYKSRNMPCPKDIT----------QNHEDD--NEKVM 119
            |..||.:||||:|:||.|:|||..|...||:.|.:..||.:.          |..:.|  .:.|.
Zfish   111 IRPDRQLQDIVFKMVPYLEEDERSRICAFYRLRGLEVPKPVASPAAYPVKLPQRQKKDLVPQSVF 175

  Fly   120 DAHAESDFHRLDEQVNVCLECIS-----NNFKNLQRRFIRCSSQATITHLKKLVAKKILNGIEKY 179
            ...:|.|       |::.||.:.     .|:|.|:|:::|.|.:||:.|::..:.:|:  .:.:.
Zfish   176 TIPSELD-------VSLMLEFVGAEKGVENYKPLERKYVRVSGEATVRHVELFIRRKM--ELSQN 231

  Fly   180 REIDILCNEELLGKDHTLKFVYVTRWR--FRDPPLRLQF 216
            .::|::|.|.:|.:..:|:.:|.|..:  .:|..|.|.|
Zfish   232 CKVDVVCGEHILEQYQSLREIYNTMGKKALQDGMLVLHF 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)73AhNP_001246797.1 RING-HC_PCGF3 13..59 CDD:319649 27/45 (60%)
RAWUL_PCGF3 133..217 CDD:340603 24/91 (26%)
pcgf6NP_001082838.1 zf-C3HC4 60..98 CDD:278524 25/37 (68%)
RAWUL 196..253 CDD:292824 15/58 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203951at2759
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.