DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)73Ah and pcgf1

DIOPT Version :9

Sequence 1:NP_001246797.1 Gene:l(3)73Ah / 48903 FlyBaseID:FBgn0002283 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_009305970.1 Gene:pcgf1 / 368900 ZFINID:ZDB-GENE-030616-605 Length:294 Species:Danio rerio


Alignment Length:230 Identity:97/230 - (42%)
Similarity:146/230 - (63%) Gaps:23/230 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ERRVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTCDNIIHQSHPLQY 66
            |.::|:|.:|.||.|.:|.||||||||:|||||||||||:||:|:..|.||.|:..||::.||..
Zfish    65 EVKIKIKDLNEHIVCYLCAGYFIDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLN 129

  Fly    67 ISFDRTMQDIVYKLVPKLQEDESRRERDFYKSRNMPCPKDITQNHEDDNEKVMD---------AH 122
            :..||.||||||||||.|||.|.:|.::||:||.:   :.|.|  ....|.|.|         .|
Zfish   130 LKLDRVMQDIVYKLVPGLQESEDKRIKEFYQSRGL---ERIIQ--PSGEESVPDNTGLPYTSFDH 189

  Fly   123 AESDFHRLDEQVNVCLECISNNF------KNLQRRFIRCSSQATITHLKKLVAKKILNGIEKYRE 181
            :::.|:|.||||::|||..|::|      |...::|:|||.:|.:.||:|::..::  .:||: :
Zfish   190 SKAHFYRYDEQVSLCLERQSSSFSGKDKNKLTLQKFVRCSVRAEVRHLRKVLCHRL--NVEKH-Q 251

  Fly   182 IDILCNEELLGKDHTLKFVYVTRWRFRDPPLRLQF 216
            :.:|.|.|.|....|:|.::::.|..:..||.|.:
Zfish   252 VQMLFNNESLPDHMTMKRLWLSHWFGKAQPLVLHY 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)73AhNP_001246797.1 RING-HC_PCGF3 13..59 CDD:319649 30/45 (67%)
RAWUL_PCGF3 133..217 CDD:340603 28/90 (31%)
pcgf1XP_009305970.1 zf-C3HC4 79..117 CDD:278524 27/37 (73%)
RAWUL 206..286 CDD:292824 24/82 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9194
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203951at2759
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X607
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.