DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)73Ah and bmi1a

DIOPT Version :9

Sequence 1:NP_001246797.1 Gene:l(3)73Ah / 48903 FlyBaseID:FBgn0002283 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_919347.1 Gene:bmi1a / 321505 ZFINID:ZDB-GENE-030131-224 Length:322 Species:Danio rerio


Alignment Length:229 Identity:87/229 - (37%)
Similarity:130/229 - (56%) Gaps:21/229 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTCDNIIHQSHPLQYIS 68
            |:|:..:|||:.|.:||||||||||:.||||:|||.|:|::||..|.||.||..:|::.||..|.
Zfish     8 RIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKMCIVRYLETSKYCPICDVQVHKTKPLLNIR 72

  Fly    69 FDRTMQDIVYKLVPKLQEDESRRERDFYKSRNMPCPKDITQNHEDDNE------------KVMDA 121
            .|:|:|||||||||.|.::|.:|.||||...  |.......::||..|            :::..
Zfish    73 SDKTLQDIVYKLVPGLFKNEMKRRRDFYAEH--PSVDAANGSNEDRGEVADEDKRIITDDEIISL 135

  Fly   122 HAESDFHRLDEQVNVCLECISNNFKNLQRRFIRCSSQATITHLKKLVAKKILNGIEKYREIDILC 186
            ..|...||..:|  .|.|.......| .:|:::|.:..|:.||:|.:..|:  .|....:|:::.
Zfish   136 SIEFFDHRAQQQ--GCTEERQKEEVN-NKRYLQCPAAMTVMHLRKFLRSKM--DIPPTYQIEVMY 195

  Fly   187 NEELLGKDHTL-KFVYVTRWRFRDPPLRLQFRPR 219
            .:|.|...:|| ...|:..|| |:.||.|::|.|
Zfish   196 EDEPLKDYYTLMDIAYIYTWR-RNGPLPLKYRVR 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)73AhNP_001246797.1 RING-HC_PCGF3 13..59 CDD:319649 28/45 (62%)
RAWUL_PCGF3 133..217 CDD:340603 24/84 (29%)
bmi1aNP_919347.1 rad18 10..>201 CDD:273165 74/197 (38%)
zf-C3HC4 20..58 CDD:278524 25/37 (68%)
RAWUL 152..226 CDD:292824 21/77 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9194
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.