DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)73Ah and Pcgf1

DIOPT Version :9

Sequence 1:NP_001246797.1 Gene:l(3)73Ah / 48903 FlyBaseID:FBgn0002283 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001007001.2 Gene:Pcgf1 / 312480 RGDID:1549782 Length:259 Species:Rattus norvegicus


Alignment Length:228 Identity:92/228 - (40%)
Similarity:145/228 - (63%) Gaps:21/228 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ERRVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTCDNIIHQSHPLQY 66
            |.|||:|.:|.||.|.:|.|||:||||:|||||||||||:||:|:..|.||.|:..||::.||..
  Rat    33 EVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLN 97

  Fly    67 ISFDRTMQDIVYKLVPKLQEDESRRERDFYKSRNMPCPKDITQNHEDDNEKVMDA--------HA 123
            :..||.||||||||||.||:.|.:|.|:||:||.:    |.......:...:.:.        |:
  Rat    98 LKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGL----DRVSQPSGEEPALSNLGLPFSSFDHS 158

  Fly   124 ESDFHRLDEQVNVCLECISN----NFKNLQRRFIRCSSQATITHLKKLVAKKI-LNGIEKYREID 183
            ::.::|.|||:::|||.:|:    |...||.:::|||.:|.:.||::::..:: ||.    :.:.
  Rat   159 KAHYYRYDEQLSLCLERLSSGKDKNKNVLQNKYVRCSVRAEVRHLRRVLCHRLMLNP----QHVQ 219

  Fly   184 ILCNEELLGKDHTLKFVYVTRWRFRDPPLRLQF 216
            :|.:.|:|....|:|.::::||..:..||.||:
  Rat   220 LLFDNEVLPDHMTMKQLWLSRWFGKPSPLLLQY 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)73AhNP_001246797.1 RING-HC_PCGF3 13..59 CDD:319649 29/45 (64%)
RAWUL_PCGF3 133..217 CDD:340603 27/89 (30%)
Pcgf1NP_001007001.2 RING-HC_PCGF1 44..86 CDD:319647 28/41 (68%)
RAWUL_PCGF1 166..253 CDD:340601 29/91 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203951at2759
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X607
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.