DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)73Ah and Pcgf6

DIOPT Version :9

Sequence 1:NP_001246797.1 Gene:l(3)73Ah / 48903 FlyBaseID:FBgn0002283 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_008758660.1 Gene:Pcgf6 / 309457 RGDID:1306904 Length:365 Species:Rattus norvegicus


Alignment Length:220 Identity:87/220 - (39%)
Similarity:125/220 - (56%) Gaps:28/220 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ERRVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTCDNIIHQSHPLQY 66
            ||.:.|..:.|:|.|.||.||.|||||:|||||||||||:|:|......||.|:.::||:.||..
  Rat   121 ERLINLVELTPYILCSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQPLYN 185

  Fly    67 ISFDRTMQDIVYKLVPKLQEDESRRERDFYKSRNMPCPKD---------ITQNHEDDNEKVMDAH 122
            |..||.:||||||||..|:|.|.::..||||.|.:..||.         :.|.......:...| 
  Rat   186 IRLDRQLQDIVYKLVVNLEEREKKQMHDFYKERGLEVPKPASLFPSQIAVPQPVPASKGRTKKA- 249

  Fly   123 AESDFH---RLDEQVNVCLECISNN-----------FKNLQRRFIRCSSQATITHLKKLVAKKIL 173
            .||.|.   .||  |::.||.|..|           |:.|:::|:|.|.:|||.|::|.:.:|: 
  Rat   250 LESVFRIPPELD--VSLLLEFIGANEDTGHFKHSLRFEPLEKKFVRVSGEATIGHVEKFLRRKM- 311

  Fly   174 NGIEKYREIDILCNEELLGKDHTLK 198
             |::...::||:|.:.||.:..||:
  Rat   312 -GLDPACQVDIICGDHLLERYQTLR 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)73AhNP_001246797.1 RING-HC_PCGF3 13..59 CDD:319649 27/45 (60%)
RAWUL_PCGF3 133..217 CDD:340603 24/77 (31%)
Pcgf6XP_008758660.1 RING-HC_PCGF6 131..175 CDD:319652 28/43 (65%)
COG5222 <135..258 CDD:227547 56/123 (46%)
RAWUL_PCGF6 261..356 CDD:340605 25/79 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203951at2759
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.