DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)73Ah and Bmi1

DIOPT Version :9

Sequence 1:NP_001246797.1 Gene:l(3)73Ah / 48903 FlyBaseID:FBgn0002283 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001100838.1 Gene:Bmi1 / 307151 RGDID:1307403 Length:324 Species:Rattus norvegicus


Alignment Length:241 Identity:92/241 - (38%)
Similarity:133/241 - (55%) Gaps:45/241 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTCDNIIHQSHPLQYIS 68
            |:|:..:|||:.|.:||||||||||:.||||:|||:|:|::||..|.||.||..:|::.||..|.
  Rat     6 RIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIR 70

  Fly    69 FDRTMQDIVYKLVPKLQEDESRRERDFYKSRNMPCPK-DITQNHEDDNEKVMDAH----AESD-- 126
            .|:|:|||||||||.|.::|.:|.||||.:.    |. |......:|..:|.|..    |:.:  
  Rat    71 SDKTLQDIVYKLVPGLFKNEMKRRRDFYAAH----PSADAANGSNEDRGEVADEDRRVIADDEII 131

  Fly   127 ------FH--RLD---------EQVNVCLECISNNFKNLQRRFIRCSSQATITHLKKLVAKKILN 174
                  ||  |.|         |:||             .:|::||.:..|:.||:|.:..|:  
  Rat   132 SLSIEFFHPSRSDRKVTKEKPKEEVN-------------DKRYLRCPAALTVMHLRKFLRSKM-- 181

  Fly   175 GIEKYREIDILCNEELLGKDHTL-KFVYVTRWRFRDPPLRLQFRPR 219
            .|....:||::..||.|...:|| ...|:..|| |:.||.|::|.|
  Rat   182 DIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWR-RNGPLPLKYRVR 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)73AhNP_001246797.1 RING-HC_PCGF3 13..59 CDD:319649 28/45 (62%)
RAWUL_PCGF3 133..217 CDD:340603 25/84 (30%)
Bmi1NP_001100838.1 RING-HC_PCGF4 12..65 CDD:319650 31/52 (60%)
RAWUL_PCGF4 130..224 CDD:340685 30/109 (28%)
PRK10803 <222..>279 CDD:182745 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.