DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)73Ah and RGD1562871

DIOPT Version :9

Sequence 1:NP_001246797.1 Gene:l(3)73Ah / 48903 FlyBaseID:FBgn0002283 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001100405.1 Gene:RGD1562871 / 302366 RGDID:1562871 Length:232 Species:Rattus norvegicus


Alignment Length:124 Identity:56/124 - (45%)
Similarity:80/124 - (64%) Gaps:5/124 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ERRVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTCDNIIHQSHPLQY 66
            ||.:.|..:.|:|:|.||.||.|||.|:|||||||||||:|||.|....||.|:.|:|::.|...
  Rat   109 ERLLPLSEMIPYISCSICKGYLIDAATITECLHTFCKSCIVKHFEHSNRCPKCNIIVHEAKPHNN 173

  Fly    67 ISFDRTMQDIVYKLVPKLQEDESRRERDFYKSR--NMPCPKDITQ---NHEDDNEKVMD 120
            :..|..:|:||||||..|:|.|.::.|:|||..  ..|.|..:.|   :.|::.::|:|
  Rat   174 LRMDPQLQNIVYKLVSGLEEKEKKQRREFYKENRGQTPKPAAVPQPGPSSEENTKEVVD 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)73AhNP_001246797.1 RING-HC_PCGF3 13..59 CDD:319649 29/45 (64%)
RAWUL_PCGF3 133..217 CDD:340603
RGD1562871NP_001100405.1 zf-C3HC4 123..161 CDD:278524 26/37 (70%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D498478at33208
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.