DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)73Ah and PCGF3

DIOPT Version :9

Sequence 1:NP_001246797.1 Gene:l(3)73Ah / 48903 FlyBaseID:FBgn0002283 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001304765.1 Gene:PCGF3 / 10336 HGNCID:10066 Length:242 Species:Homo sapiens


Alignment Length:242 Identity:135/242 - (55%)
Similarity:172/242 - (71%) Gaps:22/242 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERRVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTCDNIIHQSHPLQ 65
            :.|::||..||.||||::|.||.||||||||||||||:|||||:|||..|||||..:||||||||
Human     2 LTRKIKLWDINAHITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRIVIHQSHPLQ 66

  Fly    66 YISFDRTMQDIVYKLVPKLQEDESRRERDFYKSRNMPCPKDI----------TQNHEDDNEKVMD 120
            ||..|||||||||||||.|||.|.|::|:||....|..|.||          ..:|.:...|..|
Human    67 YIGHDRTMQDIVYKLVPGLQEAEMRKQREFYHKLGMEVPGDIKGETCSAKQHLDSHRNGETKADD 131

  Fly   121 A----------HAESDFHRLDEQVNVCLECISNNFKNLQRRFIRCSSQATITHLKKLVAKKILNG 175
            :          ..::|:||.||||::||||.|:..:.|:|::||||:|||:.||||.:|||:  .
Human   132 SSNKEAAEEKPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFIAKKL--N 194

  Fly   176 IEKYREIDILCNEELLGKDHTLKFVYVTRWRFRDPPLRLQFRPRVEL 222
            :..:.|:|||||||:||||||||||.||||||:..||.|.:||:::|
Human   195 LSSFNELDILCNEEILGKDHTLKFVVVTRWRFKKAPLLLHYRPKMDL 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)73AhNP_001246797.1 RING-HC_PCGF3 13..59 CDD:319649 34/45 (76%)
RAWUL_PCGF3 133..217 CDD:340603 50/83 (60%)
PCGF3NP_001304765.1 RING-HC_PCGF3 14..60 CDD:319649 34/45 (76%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..149 4/33 (12%)
Interaction with BCORL1. /evidence=ECO:0000269|PubMed:27568929 132..242 58/112 (52%)
RAWUL_PCGF3 154..236 CDD:340603 50/83 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159805
Domainoid 1 1.000 99 1.000 Domainoid score I7159
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4605
Inparanoid 1 1.050 282 1.000 Inparanoid score I2881
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48635
OrthoDB 1 1.010 - - D1203951at2759
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 1 1.000 - - oto90472
orthoMCL 1 0.900 - - OOG6_107223
Panther 1 1.100 - - LDO PTHR45893
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3764
SonicParanoid 1 1.000 - - X607
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.