DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)73Ah and pcgf5

DIOPT Version :9

Sequence 1:NP_001246797.1 Gene:l(3)73Ah / 48903 FlyBaseID:FBgn0002283 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_012822233.1 Gene:pcgf5 / 101734913 XenbaseID:XB-GENE-962043 Length:260 Species:Xenopus tropicalis


Alignment Length:267 Identity:101/267 - (37%)
Similarity:154/267 - (57%) Gaps:59/267 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ERRVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTCDNIIHQSHPLQY 66
            :||..:|..||||||.||.||.|..||||||||||||:|:|:|.||...||.|.|.:|:::||:.
 Frog     4 QRRRFVKEFNPHITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEESNDCPKCGNQVHETNPLEM 68

  Fly    67 ISFDRTMQDIVYKLVPKLQEDESRRERDFYKSR----------NMPCPKDITQNHEDDNEKVMDA 121
            :..|.|:::|::||||.|:|.|..||.:|:|.:          |:..|::..:.::||.      
 Frog    69 LRLDNTLEEIIFKLVPGLREGEQNRELEFWKRKQPHENGDDGVNVKRPREDEEENDDDR------ 127

  Fly   122 HAESDFHRLDEQVNVCLECISNN-------FKNLQRRFIRCSSQATITHLKKLVAKKILNGIEKY 179
                |:||.|.|:.:||:|:.||       .|.|.::|||||::.|:..:||.::.|:  .:...
 Frog   128 ----DYHRSDPQIAICLDCLRNNSQSGDNIVKGLMKKFIRCSTRVTVGTIKKFLSLKL--KLPST 186

  Fly   180 REIDILCNEELLGKDHTLKFVYVTRWRFRDP------------------------------PLRL 214
            .|:|:|||.|::|||||::|:|:||||.|..                              |:.|
 Frog   187 YELDVLCNGEIMGKDHTMEFIYMTRWRLRGENFQYQKSSTSLHMSLTETARGVSEASTISYPMVL 251

  Fly   215 QFRPRVE 221
            |:|||::
 Frog   252 QYRPRID 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)73AhNP_001246797.1 RING-HC_PCGF3 13..59 CDD:319649 30/45 (67%)
RAWUL_PCGF3 133..217 CDD:340603 38/120 (32%)
pcgf5XP_012822233.1 COG5222 <13..112 CDD:227547 49/98 (50%)
RING-HC_PCGF3 15..61 CDD:319649 30/45 (67%)
RAWUL_PCGF5 133..260 CDD:340604 42/128 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203951at2759
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X607
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.