DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)73Ah and COMMD3-BMI1

DIOPT Version :9

Sequence 1:NP_001246797.1 Gene:l(3)73Ah / 48903 FlyBaseID:FBgn0002283 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001190991.1 Gene:COMMD3-BMI1 / 100532731 HGNCID:48326 Length:469 Species:Homo sapiens


Alignment Length:230 Identity:93/230 - (40%)
Similarity:136/230 - (59%) Gaps:21/230 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTCDNIIHQSHPLQYIS 68
            |:|:..:|||:.|.:||||||||||:.||||:|||:|:|::||..|.||.||..:|::.||..|.
Human   149 RIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIR 213

  Fly    69 FDRTMQDIVYKLVPKLQEDESRRERDFYKSRNMPCPKDITQNHED-----DNEK--VMDAHAES- 125
            .|:|:|||||||||.|.::|.:|.||||.:.  |.......::||     |.:|  :.|....| 
Human   214 SDKTLQDIVYKLVPGLFKNEMKRRRDFYAAH--PSADAANGSNEDRGEVADEDKRIITDDEIISL 276

  Fly   126 -----DFHRLDEQVNVCLECISNNFKNLQRRFIRCSSQATITHLKKLVAKKILNGIEKYREIDIL 185
                 |.:|||.:||...|.......:  :|::||.:..|:.||:|.:..|:  .|....:||::
Human   277 SIEFFDQNRLDRKVNKDKEKSKEEVND--KRYLRCPAAMTVMHLRKFLRSKM--DIPNTFQIDVM 337

  Fly   186 CNEELLGKDHTL-KFVYVTRWRFRDPPLRLQFRPR 219
            ..||.|...:|| ...|:..|| |:.||.|::|.|
Human   338 YEEEPLKDYYTLMDIAYIYTWR-RNGPLPLKYRVR 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)73AhNP_001246797.1 RING-HC_PCGF3 13..59 CDD:319649 28/45 (62%)
RAWUL_PCGF3 133..217 CDD:340603 26/84 (31%)
COMMD3-BMI1NP_001190991.1 HCaRG 20..>125 CDD:284632
zf-C3HC4 161..199 CDD:278524 25/37 (68%)
RAWUL 291..369 CDD:292824 25/82 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.