DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)73Ah and pcgf6

DIOPT Version :9

Sequence 1:NP_001246797.1 Gene:l(3)73Ah / 48903 FlyBaseID:FBgn0002283 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_002936851.2 Gene:pcgf6 / 100489850 XenbaseID:XB-GENE-6258271 Length:295 Species:Xenopus tropicalis


Alignment Length:204 Identity:79/204 - (38%)
Similarity:117/204 - (57%) Gaps:10/204 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ERRVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTCDNIIHQSHPLQY 66
            |..:.|..:||:|.|.||.||.|||||:|||||||||||:|||......||.|:.::||:.||..
 Frog    65 EHMINLTDLNPYILCSICKGYLIDATTITECLHTFCKSCIVKHFYYTNRCPKCNIVVHQTQPLYN 129

  Fly    67 ISFDRTMQDIVYKLVPKLQEDESRRERDFYKSRNMPCPKDITQNHEDDNEKVMDAHAESDFHRLD 131
            |..||.:||||:|||..|::.|..:...|||.|.:..||.........:........|..| |:.
 Frog   130 IRLDRQLQDIVFKLVVDLEQREKNQMYAFYKERGLDVPKHNVPQPISSSRAKQKKTIEPVF-RIP 193

  Fly   132 EQVNVCL-------ECISNNFKNLQRRFIRCSSQATITHLKKLVAKKILNGIEKYREIDILCNEE 189
            .:::|.|       |..:.:||.|:::::|.|.:|||.|::|.:.:|:  .:....::||:|.:.
 Frog   194 PELDVSLLLEFMGAEKGTGSFKPLEKKYVRVSGEATIGHVEKFLRRKM--ELNTTCQVDIICGDH 256

  Fly   190 LLGKDHTLK 198
            ||....|||
 Frog   257 LLEHFQTLK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)73AhNP_001246797.1 RING-HC_PCGF3 13..59 CDD:319649 28/45 (62%)
RAWUL_PCGF3 133..217 CDD:340603 22/73 (30%)
pcgf6XP_002936851.2 RING-HC_PCGF6 75..119 CDD:319652 29/43 (67%)
RAWUL_PCGF6 197..279 CDD:340605 22/71 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203951at2759
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.