DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5504 and Dnaja2

DIOPT Version :9

Sequence 1:NP_995932.1 Gene:CG5504 / 48844 FlyBaseID:FBgn0002174 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_114468.2 Gene:Dnaja2 / 84026 RGDID:71001 Length:412 Species:Rattus norvegicus


Alignment Length:470 Identity:122/470 - (25%)
Similarity:197/470 - (41%) Gaps:103/470 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 YATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPDAGRKFQEVSEAYEVLSDEQKRREYDTYGQ 131
            |..|||...|:..::||||.:|||:||||.|   |:||.||:|:|.||||||:.:||..||.||:
  Rat    10 YDILGVPPGASENELKKAYRKLAKEYHPDKN---PNAGDKFKEISFAYEVLSNPEKRELYDRYGE 71

  Fly   132 TAENIGRQGGGFPGGGAGGFGPEGFSQSWQFRSSIDPEELFRKIFGEGNFRTNSFDDFADSKFGF 196
                   ||.....||.||.                 :::|..|||.|.|  ....:.:.|:.|.
  Rat    72 -------QGLREGSGGGGGM-----------------DDIFSHIFGGGLF--GFMGNQSRSRNGR 110

  Fly   197 GQAQEMV----MDLTFAQAARGVNKDVNVNVVDQCPKCAGTKCEPGTKPG---RCQYCNGTGFET 254
            .:.::|:    :.|......:.....::.||:  |..|:|    .|.|.|   :|..|.|.|...
  Rat   111 RRGEDMMHPLKVSLEDLYNGKTTKLQLSKNVL--CSACSG----QGGKSGAVQKCSACRGRGVRI 169

  Fly   255 V--STGPFV---MRSTCRYCQGTRQHI--KYPCSECEGKGRTVQRRKVTVPVPAGIENGQTVRMQ 312
            :  ...|.:   |:|.|..|.|..:.|  |..|.:||||....:.:.:.|.|..|:::||.:...
  Rat   170 MIRQLAPGMVQQMQSVCSDCNGEGEVINEKDRCKKCEGKKVIKEVKILEVHVDKGMKHGQRITFT 234

  Fly   313 --------VGSKELFVTFRVERSDYFRREGADVHTDAAISLAQAVLGGTVRVQGVYEDQWI---- 365
                    |...::.:..:.:..:.|:|:|.|:|....|.|.:|:.|.....:.:...|.:    
  Rat   235 GEADQAPGVEPGDIVLLLQEKEHEVFQRDGNDLHMTYKIGLVEALCGFQFTFKHLDARQIVVKYP 299

  Fly   366 ---NVEPGTSSHHKIMLRGKGLKRV-NAHGHGDHYVHVKITVPSAKKLDKKRLALIEAYAELEED 426
               .:|||...    ::||:|:.:. |....||.|:...:..|....::..:|:.:|.......:
  Rat   300 PGKVIEPGCVR----VVRGEGMPQYRNPFEKGDLYIKFDVQFPENNWINPDKLSELEDLLPSRPE 360

  Fly   427 TPGQIHGIANRKDGSKQATAGASEEPGAGAAAKASAAAAGSGASKPGPGAEKSEGKDQWTDNEKT 491
            .|..|               |.:||    ...:...:..|||      |.::.|..:..:|.|  
  Rat   361 VPNVI---------------GETEE----VELQEFDSTRGSG------GGQRREAYNDSSDEE-- 398

  Fly   492 KAKEGGGSGSGQGDG 506
                   |.|..|.|
  Rat   399 -------SSSHHGPG 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5504NP_995932.1 DnaJ 63..437 CDD:223560 108/399 (27%)
DnaJ 65..127 CDD:278647 32/59 (54%)
DnaJ_zf 227..287 CDD:199908 22/69 (32%)
DnaJ_C 288..409 CDD:199909 27/136 (20%)
Dnaja2NP_114468.2 PTZ00037 4..412 CDD:240236 122/470 (26%)
CXXCXGXG motif 143..150 3/10 (30%)
CXXCXGXG motif 159..166 3/6 (50%)
CXXCXGXG motif 186..193 3/6 (50%)
CXXCXGXG motif 202..209 4/6 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..412 15/76 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.