DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5504 and NdhT

DIOPT Version :10

Sequence 1:NP_995932.1 Gene:CG5504 / 48844 FlyBaseID:FBgn0002174 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_192673.1 Gene:NdhT / 826517 AraportID:AT4G09350 Length:249 Species:Arabidopsis thaliana


Alignment Length:71 Identity:33/71 - (46%)
Similarity:45/71 - (63%) Gaps:5/71 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LAKD----YYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKED-PDAGRKFQEVSEAYEVLSDEQ 121
            |.||    :|..|||:.:|:.::||.||.:|:|:|||||.... ..|..||.::.|.|.|||||:
plant    99 LIKDSFDSHYQFLGVSTDADLEEIKSAYRRLSKEYHPDTTSLPLKTASEKFMKLREVYNVLSDEE 163

  Fly   122 KRREYD 127
            .||.||
plant   164 TRRFYD 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5504NP_995932.1 djlA <9..117 CDD:236512 24/59 (41%)
DnaJ_bact 65..424 CDD:274090 31/68 (46%)
NdhTNP_192673.1 DnaJ 106..169 CDD:395170 28/62 (45%)

Return to query results.
Submit another query.