DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5504 and Dnajb1

DIOPT Version :9

Sequence 1:NP_995932.1 Gene:CG5504 / 48844 FlyBaseID:FBgn0002174 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_061278.1 Gene:Dnajb1 / 81489 MGIID:1931874 Length:340 Species:Mus musculus


Alignment Length:374 Identity:111/374 - (29%)
Similarity:169/374 - (45%) Gaps:82/374 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LAKDYYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPDAGRKFQEVSEAYEVLSDEQKRREY 126
            :.||||.|||:|:.|:..:||:||.:.|.:||||.||| |.|..||:|::|||:||||.:||..:
Mouse     1 MGKDYYQTLGLARGASDDEIKRAYRRQALRYHPDKNKE-PGAEEKFKEIAEAYDVLSDPRKREIF 64

  Fly   127 DTYGQTAENIGRQG--GGFPGGGAGGFGPEGFSQSWQFRSSIDPEELFRKIFGEGNFRTNSFDDF 189
            |.||:       :|  ||.|.||:.| |..|.|.|:.|..  ||..:|.:.||    ..|.||.|
Mouse    65 DRYGE-------EGLKGGSPSGGSSG-GANGTSFSYTFHG--DPHAMFAEFFG----GRNPFDTF 115

  Fly   190 ADSKFGFGQ---AQEMVMDLTFAQAARGVNKDVNVNVVDQCPKCAGTKCE---PGTKPGRCQYCN 248
                  |||   .:.|.:|.||:....|:....|:|.....|....|:.:   |.|...|     
Mouse   116 ------FGQRNGEEGMDIDDTFSSFPMGMGGFTNMNFGRSRPSQEPTRKKQDPPVTHDLR----- 169

  Fly   249 GTGFETVSTGPFVMRSTCRYCQGTRQHIKYPCSECEGKGRTVQRRKVTVPVPAGIENGQTVRM-- 311
             ...|.:.:|          |. .:..|.:.....:||....:.:.:|:.|..|.:.|..:..  
Mouse   170 -VSLEEIYSG----------CT-KKMKISHKRLNPDGKSIRNEDKILTIEVKRGWKEGTKITFPK 222

  Fly   312 ---QVGSK---ELFVTFRVERSDYFRREGADVHTDAAISLAQAVLGGTVRVQG--------VYED 362
               |..:.   ::....:.:..:.|:|:|:||...|.|||.:|:.|.||.|..        |::|
Mouse   223 EGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKD 287

  Fly   363 QWINVEPGTSSHHKIMLRGKGL-------KRVNAHGHGDHYVHVKITVP 404
            .   :.||.    :..:.|:||       ||      ||..:..::..|
Mouse   288 V---IRPGM----RRKVPGEGLPLPKTPEKR------GDLVIEFEVIFP 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5504NP_995932.1 DnaJ 63..437 CDD:223560 111/373 (30%)
DnaJ 65..127 CDD:278647 34/61 (56%)
DnaJ_zf 227..287 CDD:199908 10/62 (16%)
DnaJ_C 288..409 CDD:199909 31/140 (22%)
Dnajb1NP_061278.1 DnaJ 1..340 CDD:223560 111/374 (30%)
DnaJ 4..65 CDD:278647 34/61 (56%)
DnaJ_C 162..326 CDD:199909 40/192 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.