DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5504 and Dnajb2

DIOPT Version :9

Sequence 1:NP_995932.1 Gene:CG5504 / 48844 FlyBaseID:FBgn0002174 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_006245338.1 Gene:Dnajb2 / 689593 RGDID:1591035 Length:324 Species:Rattus norvegicus


Alignment Length:430 Identity:112/430 - (26%)
Similarity:169/430 - (39%) Gaps:126/430 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 YYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPD-AGRKFQEVSEAYEVLSDEQKRREYDTY 129
            ||..|.|.::|:..||||||.:.|.::|||.|.::.: |.:||:||:||||||||:.||..||.|
  Rat     4 YYEILDVPRSASPDDIKKAYRKKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRY 68

  Fly   130 GQTAENIGRQGGGFPGGGAGGFGPEGFSQSWQFRSSIDPEELFRKIFGEGNFRTNSFDDFADSKF 194
            |:  |.:...|.|......||..| ||  ::.|||   |||:||:.||.|:..:..|||..    
  Rat    69 GR--EGLTGAGSGPSRSETGGMEP-GF--TFTFRS---PEEVFREFFGSGDPFSELFDDLG---- 121

  Fly   195 GFGQAQEMVMDL-----TFAQAARGVNKDVNVNVVDQCPKCAGTKCEPGTKPGRCQYCNGTG-FE 253
            .|.:.|.....|     ||:.:..| |.|.:.:.....|                    |.| |.
  Rat   122 AFSELQNQGSRLTGPFFTFSSSFPG-NSDFSSSSFSFSP--------------------GAGAFR 165

  Fly   254 TVSTG-PFVMRSTCRYCQGTRQHIKYPCSECEGKGRTVQRRKVTVPVPAGIENGQTVRMQVGSKE 317
            :|||. .||                        :||.:..|::       :||||          
  Rat   166 SVSTSTTFV------------------------QGRRITTRRI-------MENGQ---------- 189

  Fly   318 LFVTFRVERSDYFRREGADVHTDAAISLAQAVLGGTVRVQGVYEDQWINVEPGTSSHHKIMLRGK 382
                           |..:|..|..:.        :|.:.||.:|..:.:|.........:..|.
  Rat   190 ---------------ERVEVEEDGQLK--------SVSINGVPDDLALGLELSRREQQPSVTPGL 231

  Fly   383 GLKRVNAHGHGDHYVHVKITVPSAKKL-DKKRLALIEAYAELEEDTPGQI----HGIANRKDGSK 442
            |:.:|..         ..::.|....| :.:.:.|..||:..|.:..||.    .|...|:.|..
  Rat   232 GVMQVRP---------TSVSRPPDSDLSEDEDMQLAMAYSLSEMEASGQKPAGGRGAPQRQHGQP 287

  Fly   443 QATAGASEEPGAGAAAKASAAAAGSGASKPGPGAEKSEGK 482
            :|   ..::|..|...|    .|...|:|..|.:|:...:
  Rat   288 KA---QHQDPDVGGLHK----GARGEAAKVSPSSEEKASR 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5504NP_995932.1 DnaJ 63..437 CDD:223560 101/383 (26%)
DnaJ 65..127 CDD:278647 31/61 (51%)
DnaJ_zf 227..287 CDD:199908 9/61 (15%)
DnaJ_C 288..409 CDD:199909 18/120 (15%)
Dnajb2XP_006245338.1 DnaJ 3..>110 CDD:223560 53/113 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.