DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5504 and dnajc10

DIOPT Version :9

Sequence 1:	NP_995932.1	Gene:	CG5504 / 48844	FlyBaseID:	FBgn0002174	Length:	520	Species:	Drosophila melanogaster
Sequence 2:	NP_001077016.1	Gene:	dnajc10 / 557858	ZFINID:	ZDB-GENE-070327-1	Length:	791	Species:	Danio rerio

Alignment Length:	114	Identity:	39/114 - (34%)
Similarity:	60/114 - (52%)	Gaps:	23/114 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly    64 KDYYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPDAGRKFQEVSEAYEVLSDEQKRREYDT 128
            :|||..||:::.|:.:||::|:.:||...|||.|..|..|..||.:::.|||||.||..|::||.
Zfish    32 EDYYKLLGISREASTRDIRQAFKKLALTMHPDKNPNDETAHDKFLKINRAYEVLKDEDLRKKYDK 96

  Fly   129 YGQTAENIGRQGGGFPGGGAGGFGPEGFSQSWQFRSSIDPEELFRKIFG 177
            ||:......:|||.:              :||.:         :|..||
Zfish    97 YGEKGLQDEQQGGRY--------------ESWNY---------YRYDFG 122

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5504	NP_995932.1	DnaJ	63..437	CDD:223560	39/114 (34%)
		DnaJ	65..127	CDD:278647	27/61 (44%)
		DnaJ_zf	227..287	CDD:199908
		DnaJ_C	288..409	CDD:199909
dnajc10	NP_001077016.1	DnaJ	33..>129	CDD:223560	39/113 (35%)
		DnaJ	33..95	CDD:278647	27/61 (44%)
		PDI_a_ERdj5_N	128..228	CDD:239301
		ER_PDI_fam	129..648	CDD:273457
		Thioredoxin_like	<276..318	CDD:294274
		PDI_a_family	348..443	CDD:239259
		PDI_a_ERdj5_C	450..546	CDD:239302
		PDI_a_ERdj5_C	552..660	CDD:239302
		PDI_a_ERdj5_C	666..772	CDD:239302
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910