DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5504 and DNAJA4

DIOPT Version :9

Sequence 1:NP_995932.1 Gene:CG5504 / 48844 FlyBaseID:FBgn0002174 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_061072.3 Gene:DNAJA4 / 55466 HGNCID:14885 Length:426 Species:Homo sapiens


Alignment Length:474 Identity:123/474 - (25%)
Similarity:190/474 - (40%) Gaps:106/474 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SSAGSGSTRADAPQVRRLHTTRDLLAKDYYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPD 102
            |....|..:...|:..|....::   ..||..|||..:|:.::|||||.:||.|||||.|   ||
Human    11 SGESDGQPKEQTPEKPRHKMVKE---TQYYDILGVKPSASPEEIKKAYRKLALKYHPDKN---PD 69

  Fly   103 AGRKFQEVSEAYEVLSDEQKRREYDTYGQTAENIGRQGGGFPGGGAGGFGPEGFSQSWQFRSSID 167
            .|.||:.:|:|||||||.:||..||..|:.|..            .||.|...||         .
Human    70 EGEKFKLISQAYEVLSDPKKRDVYDQGGEQAIK------------EGGSGSPSFS---------S 113

  Fly   168 PEELFRKIFGEGNFRTNSFDDFADSKFGFGQAQEMVMDLTFAQAARGVNKDVNV--NVVDQCPKC 230
            |.::|...||.|.       ..|..:.|.....:  :.:|......||.|.:.:  ||:  |.||
Human   114 PMDIFDMFFGGGG-------RMARERRGKNVVHQ--LSVTLEDLYNGVTKKLALQKNVI--CEKC 167

  Fly   231 AGTKCEPGTKPG---RCQYCNGTGFE--TVSTGPFV---MRSTCRYC--QGTRQHIKYPCSECEG 285
            .|.    |.|.|   :|..|.|.|.:  ....||.:   :::.|..|  ||.|.:.|..|..|.|
Human   168 EGV----GGKKGSVEKCPLCKGRGMQIHIQQIGPGMVQQIQTVCIECKGQGERINPKDRCESCSG 228

  Fly   286 KGRTVQRRKVTVPVPAGIENGQTV----------RMQVGSKELFVTFRVERSDY--FRREGADVH 338
            .....:::.:.|.|..|:::||.:          .::.|.    |...:::.|:  |:|.|.|:.
Human   229 AKVIREKKIIEVHVEKGMKDGQKILFHGEGDQEPELEPGD----VIIVLDQKDHSVFQRRGHDLI 289

  Fly   339 TDAAISLAQAVLGGTVRVQGVYEDQWINVEPGTSSHHKIMLRGKGLKRVNAHG---------HGD 394
            ....|.|::|:.|....::.:  |..|.|.  ||...:::..| .|:.|...|         .|.
Human   290 MKMKIQLSEALCGFKKTIKTL--DNRILVI--TSKAGEVIKHG-DLRCVRDEGMPIYKAPLEKGI 349

  Fly   395 HYVHVKITVPSAKKLDKKRLALIEA---------------YAELEEDTPGQIHGIANRKDGSKQA 444
            ..:...:..|....|..::|..:||               ..||:|..|       |.::..:..
Human   350 LIIQFLVIFPEKHWLSLEKLPQLEALLPPRQKVRITDDMDQVELKEFCP-------NEQNWRQHR 407

  Fly   445 TAGASEEPGAGAAAKASAA 463
            .|...:|.|..|..:...|
Human   408 EAYEEDEDGPQAGVQCQTA 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5504NP_995932.1 DnaJ 63..437 CDD:223560 113/421 (27%)
DnaJ 65..127 CDD:278647 34/61 (56%)
DnaJ_zf 227..287 CDD:199908 22/69 (32%)
DnaJ_C 288..409 CDD:199909 27/141 (19%)
DNAJA4NP_061072.3 PTZ00037 15..423 CDD:240236 121/465 (26%)
DnaJ 36..94 CDD:278647 34/60 (57%)
DnaJ_C 135..361 CDD:199909 55/242 (23%)
DnaJ_zf 164..230 CDD:199908 22/69 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.