DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5504 and DNAJB11

DIOPT Version :9

Sequence 1:NP_995932.1 Gene:CG5504 / 48844 FlyBaseID:FBgn0002174 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_057390.1 Gene:DNAJB11 / 51726 HGNCID:14889 Length:358 Species:Homo sapiens


Alignment Length:377 Identity:94/377 - (24%)
Similarity:144/377 - (38%) Gaps:129/377 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LLAKDYYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPDAGRKFQEVSEAYEVLSDEQKRRE 125
            :..:|:|..|||.::|:.|||||||.:||.:.|||.|.:||.|..|||::..|||||||.:||::
Human    21 IAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSDSEKRKQ 85

  Fly   126 YDTYGQTAENIGRQGGGFPGGGAGGFGPEGFSQSWQFRSSIDPEELFRKIFGEGNFRTNSFDDFA 190
            |||||:.....|.|.                                    ..|:..::.|.||.
Human    86 YDTYGEEGLKDGHQS------------------------------------SHGDIFSHFFGDFG 114

  Fly   191 DSKFGFG-----------QAQEMVMDL----------TFAQAARGVNKDVNVNVVDQCPKCAGTK 234
               |.||           :..::::||          .|.:..|  ||.|             .:
Human   115 ---FMFGGTPRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVR--NKPV-------------AR 161

  Fly   235 CEPGTKPGRCQYCNGTGFETVSTGPFVMRSTCRYCQGTRQHIKYPCSECEGKGRTVQRRKVTVPV 299
            ..||.:...|:    ....|...||      .|: |.|::.:   |.||.......:.|.:.|.:
Human   162 QAPGKRKCNCR----QEMRTTQLGP------GRF-QMTQEVV---CDECPNVKLVNEERTLEVEI 212

  Fly   300 PAGIENGQTVRMQVGSKELFV-------TFRVE--RSDYFRREGADVHTDAAISLAQAVLGGTVR 355
            ..|:.:|..... :|..|..|       .||::  :...|.|.|.|::|:..|||.::::|..:.
Human   213 EPGVRDGMEYPF-IGEGEPHVDGEPGDLRFRIKVVKHPIFERRGDDLYTNVTISLVESLVGFEMD 276

  Fly   356 VQGVYEDQWINVEPGTSSHHKIMLRGKGLKRVNAHGHGDHYVHVKITVPSAK 407
            :                              .:..||..|....|||.|.||
Human   277 I------------------------------THLDGHKVHISRDKITRPGAK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5504NP_995932.1 DnaJ 63..437 CDD:223560 94/375 (25%)
DnaJ 65..127 CDD:278647 34/61 (56%)
DnaJ_zf 227..287 CDD:199908 12/59 (20%)
DnaJ_C 288..409 CDD:199909 27/129 (21%)
DNAJB11NP_057390.1 DnaJ 22..344 CDD:223560 94/376 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.