DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5504 and dnaja2

DIOPT Version :9

Sequence 1:NP_995932.1 Gene:CG5504 / 48844 FlyBaseID:FBgn0002174 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001004807.1 Gene:dnaja2 / 448048 XenbaseID:XB-GENE-998337 Length:410 Species:Xenopus tropicalis


Alignment Length:452 Identity:117/452 - (25%)
Similarity:190/452 - (42%) Gaps:96/452 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 YATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPDAGRKFQEVSEAYEVLSDEQKRREYDTYGQ 131
            |..||||..|:..|:||||.:|||:||||.|   |:||.||:|:|.||||||:.:||..||.||:
 Frog    10 YDILGVAPGASENDLKKAYRKLAKEYHPDKN---PNAGDKFKEISFAYEVLSNPEKRELYDRYGE 71

  Fly   132 TAENIGRQGGGFPGGGAGGFGPEGFSQSWQFRSSIDPEELFRKIFGEGNFRTNSFDDFADSKFGF 196
            .....|..|.|.                         :::|..|||.|.|  ......:.|:.|.
 Frog    72 QGLREGSGGSGM-------------------------DDIFSHIFGGGLF--GFMGGQSRSRNGR 109

  Fly   197 GQAQEMV----MDLTFAQAARGVNKDVNVNVVDQCPKCAGTKCEPGTKPG---RCQYCNGTGFET 254
            .:.::|:    :.|......:.....::.||:  |..|.|    .|.|.|   :|..|.|.|...
 Frog   110 RRGEDMMHPLKVSLEDLYNGKTTKLQLSKNVL--CSSCNG----QGGKTGAVQKCSACRGRGVRV 168

  Fly   255 V--STGPFV---MRSTCRYCQGTRQHI--KYPCSECEGKGRTVQRRKVTVPVPAGIENGQTVRMQ 312
            :  ...|.:   |:|.|..|.|..:.|  |..|.:||||....:.:.:.|.|..|:::||.:...
 Frog   169 MIRQLAPGMVQQMQSVCSDCNGEGEVINEKDRCKKCEGKKVVKEVKIIEVHVDKGMKHGQRITFS 233

  Fly   313 --------VGSKELFVTFRVERSDYFRREGADVHTDAAISLAQAVLGGTVRVQGVYEDQWI---- 365
                    |...::.:..:.:..:.|:|:|.|:|....|.|.:|:.|.....:.:...|.:    
 Frog   234 GEADQAPGVEPGDIVLVLQEKEHEVFQRDGNDLHMTHRIGLVEALCGFQFTFKHLDARQIVVKYP 298

  Fly   366 ---NVEPGTSSHHKIMLRGKGLKRV-NAHGHGDHYVHVKITVPSAKKLDKKRLALIEAYAELEED 426
               .:|||:..    ::||:|:.:. |....||.::...:..|....::..:|      .|||:.
 Frog   299 PGKVIEPGSVR----VVRGEGMPQYRNPFEKGDLFIKFDVIFPENNWINPDKL------TELEDL 353

  Fly   427 TPGQIHGIANRKDGSKQATAGASEE-----------PGAGAAAKASAAAAGSGASKPGPGAE 477
            .|.:         ....|.:|.:||           ...|...:|...::...:|..|||.:
 Frog   354 LPSR---------PEAPAVSGETEEVDLQEFDNTRGSSGGQRREAYNDSSDDESSHHGPGVQ 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5504NP_995932.1 DnaJ 63..437 CDD:223560 107/399 (27%)
DnaJ 65..127 CDD:278647 34/59 (58%)
DnaJ_zf 227..287 CDD:199908 22/69 (32%)
DnaJ_C 288..409 CDD:199909 26/136 (19%)
dnaja2NP_001004807.1 PTZ00037 4..410 CDD:240236 117/452 (26%)
DnaJ 9..67 CDD:278647 34/59 (58%)
DnaJ_C 113..339 CDD:199909 53/235 (23%)
DnaJ_zf 142..208 CDD:199908 22/69 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.