DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5504 and dnajb1a

DIOPT Version :9

Sequence 1:NP_995932.1 Gene:CG5504 / 48844 FlyBaseID:FBgn0002174 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001003571.1 Gene:dnajb1a / 445177 ZFINID:ZDB-GENE-040801-90 Length:335 Species:Danio rerio


Alignment Length:403 Identity:106/403 - (26%)
Similarity:159/403 - (39%) Gaps:118/403 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LAKDYYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPDAGRKFQEVSEAYEVLSDEQKRREY 126
            :.||||..||:.|.|:.::|||||.:.|.::|||.|| ...|..||:|::|||:||||.:|:..|
Zfish     1 MGKDYYRILGIEKGASDEEIKKAYRKQALRFHPDKNK-SAGAEDKFKEIAEAYDVLSDAKKKDIY 64

  Fly   127 DTYGQTAENIGRQGGGFPG-GGAGGFGPEGFSQSWQFRSSIDPEELFRKIFGEGNFRTNSFDDF- 189
            |.||:         .|..| .|:|..||     |:.|..  ||..:|.:.||    ..:.||.| 
Zfish    65 DRYGE---------DGLKGHAGSGTNGP-----SYTFHG--DPHAMFAEFFG----GRSPFDHFF 109

  Fly   190 -----------ADSKFG-FGQAQEMVMDLTFAQAARG------------VNKDVNVNVVDQCPKC 230
                       .|..|| ||.........:|.....|            |..::.|::.:....|
Zfish   110 ASAGGPNDGMDIDDPFGAFGMGGMGGFPRSFKSRVGGPHGSREKKKDPPVVHELKVSLEEVFAGC 174

  Fly   231 AGTKCEPGTK---PGRCQYCNGTGFETVSTGPFVMRSTCRYCQGTRQHIKYPCSECEGKGRTVQR 292
            . .|.:...|   |..|...|.....||.    :.|.   :.:||                    
Zfish   175 T-KKMKISRKRLNPDGCSMRNEDKILTVD----IKRG---WKEGT-------------------- 211

  Fly   293 RKVTVPVPAGIENGQTVRMQVGSKELFVTFRVERSDYFRREGADVHTDAAISLAQAVLGGTVRVQ 357
             |:|.|     :.|......:.:..:||. :.:....|||:|:|:...|.|||.:|:.|.|:...
Zfish   212 -KITFP-----KEGDETPTNIPADIVFVV-KDKIHSVFRRDGSDIIYPARISLREALCGCTINAP 269

  Fly   358 GVYEDQWINV------EPGTSSHHKIMLRGKGL-------KRVNAHGHGDHYVHVKITVPSAKKL 409
             ..:.:.:.|      :||.    |..:.|:||       ||      ||..:...:..|     
Zfish   270 -TLDGRTVTVSSRDVIKPGM----KKRIVGEGLPLSKCPEKR------GDMVLEFSVKFP----- 318

  Fly   410 DK----KRLALIE 418
            ||    .|.||::
Zfish   319 DKLGPGAREALVQ 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5504NP_995932.1 DnaJ 63..437 CDD:223560 106/402 (26%)
DnaJ 65..127 CDD:278647 30/61 (49%)
DnaJ_zf 227..287 CDD:199908 11/62 (18%)
DnaJ_C 288..409 CDD:199909 30/133 (23%)
dnajb1aNP_001003571.1 DnaJ 1..335 CDD:223560 106/403 (26%)
DnaJ 4..65 CDD:278647 30/61 (49%)
DnaJ_C 157..321 CDD:199909 44/214 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.