DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5504 and Droj2

DIOPT Version :9

Sequence 1:NP_995932.1 Gene:CG5504 / 48844 FlyBaseID:FBgn0002174 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster


Alignment Length:344 Identity:105/344 - (30%)
Similarity:153/344 - (44%) Gaps:77/344 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 YYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPDAGRKFQEVSEAYEVLSDEQKRREYDTYG 130
            ||..|||..||...::||||.:||.|||||.|   |:.|.||:.:|:|||||||..||:.||..|
  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN---PNEGEKFKAISQAYEVLSDADKRQVYDEGG 68

  Fly   131 QTAENIGRQGGGFPGGGAGGFGPEGFSQSWQFRSSIDPEELFRKIFGEGNFRTNSFDDFADSKFG 195
            :.|.   ::||               :.|..||   :|.:.|.|.||.|         |..|  |
  Fly    69 EAAI---KKGG---------------ADSGDFR---NPMDFFEKFFGAG---------FGGS--G 101

  Fly   196 FGQAQEM-------VMDLTFAQAARGVNKDVNV--NVVDQCPKCAGTKCEPGTKPG---RCQYCN 248
            .|:.:|.       .|.:...:...|..:.:.:  ||:  |.||.|.    |.|.|   :|..|.
  Fly   102 GGRRRERRGKDVVHQMSVQLEELYNGATRKLQLQKNVI--CDKCEGR----GGKKGSIEKCLQCR 160

  Fly   249 GTGFET--VSTGPFVMR---STCRYCQGTRQHI--KYPCSECEGKGRTVQRRKV-TVPVPAGIEN 305
            |.|.||  ....|.:|:   ..||.|.||.:.|  |..|..|.|: :||:.||| .|.:..|:.:
  Fly   161 GNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQEKDRCKNCSGR-KTVRERKVLEVHIEKGMRD 224

  Fly   306 GQTV----------RMQVGSKELFVTFRVERSDYFRREGADVHTDAAISLAQAVLGGTVRVQGVY 360
            ||.:          ..|.|  ::.:....:....|...|.|:.....:.|.:| |.|..|:....
  Fly   225 GQKIVFTGEGDHEPESQPG--DIIILLDEKEHSTFAHAGQDLMMKMPLQLVEA-LCGFQRIVKTL 286

  Fly   361 EDQ--WINVEPGTSSHHKI 377
            :|:  .::.:||....|::
  Fly   287 DDRDLIVSTQPGEVIRHEM 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5504NP_995932.1 DnaJ 63..437 CDD:223560 105/344 (31%)
DnaJ 65..127 CDD:278647 33/60 (55%)
DnaJ_zf 227..287 CDD:199908 25/69 (36%)
DnaJ_C 288..409 CDD:199909 23/103 (22%)
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 105/344 (31%)
DnaJ 7..65 CDD:278647 33/60 (55%)
DnaJ_C 112..336 CDD:199909 52/204 (25%)
DnaJ_zf 140..206 CDD:199908 25/70 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440487
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.