DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5504 and CG8476

DIOPT Version :9

Sequence 1:NP_995932.1 Gene:CG5504 / 48844 FlyBaseID:FBgn0002174 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_731777.1 Gene:CG8476 / 41624 FlyBaseID:FBgn0038127 Length:242 Species:Drosophila melanogaster


Alignment Length:188 Identity:45/188 - (23%)
Similarity:72/188 - (38%) Gaps:63/188 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RILSSAGSGSTRADAPQVRRLHTTRDLLAKDYYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKE 99
            |.|::.||..|....|.       ..|.|:::|..|.|...::.::||:|:.:|:||||||.|.:
  Fly    14 RCLATFGSRFTYQSQPM-------SQLRAENHYQVLNVPVGSSDREIKRAFIELSKKYHPDANSQ 71

  Fly   100 DPDAGRKFQEVSEAYEVL---------------SDEQK---------RREYDTYGQ-----TAEN 135
            ..|: ..|.::.|||:.|               .::.|         ||.|..:.|     .::.
  Fly    72 TRDS-EVFMKICEAYQTLHRVNSRQIYDSRLRMQNQNKSPQESTFTGRRVYTVWSQYQSAVRSKQ 135

  Fly   136 IGRQGGGFPGGGAGGFGP---------------------EGFSQSWQFRSSIDPEELF 172
            :||....|     ||..|                     ||..:||..:.|.....:|
  Fly   136 MGRGSRRF-----GGVKPTIFKGKIVSKWLPMTLVDLKREGLRRSWHDKYSFPNSPIF 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5504NP_995932.1 DnaJ 63..437 CDD:223560 38/160 (24%)
DnaJ 65..127 CDD:278647 23/85 (27%)
DnaJ_zf 227..287 CDD:199908
DnaJ_C 288..409 CDD:199909
CG8476NP_731777.1 DnaJ 37..98 CDD:278647 20/61 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0715
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.