DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5504 and DnaJ-1

DIOPT Version :9

Sequence 1:NP_995932.1 Gene:CG5504 / 48844 FlyBaseID:FBgn0002174 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster


Alignment Length:383 Identity:111/383 - (28%)
Similarity:163/383 - (42%) Gaps:106/383 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LAKDYYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPDAGRKFQEVSEAYEVLSDEQKRREY 126
            :.||:|..||:.:.|:..:|||||.:||.|||||.|| .|.|..:|:|::||||||||::||..:
  Fly     1 MGKDFYKILGLERKASDDEIKKAYRKLALKYHPDKNK-SPQAEERFKEIAEAYEVLSDKKKRDIF 64

  Fly   127 DTYGQTAENIGRQGG--GFPGGGAGGFGPEGFSQSWQFRSSIDPEELFRKIFGE----GNFRTNS 185
            |.||:.    |.:||  |..|||..|      :.::||..  ||...|.:.||.    |.|.|. 
  Fly    65 DNYGED----GLKGGQPGPDGGGQPG------AYTYQFHG--DPRATFAQFFGSSDPFGAFFTG- 116

  Fly   186 FDDFADSKFGFGQ---AQEMVMDL----TFAQAARGVNKD------------VNVNVVDQCPKCA 231
                .|:.|..||   ..|:..::    .||..|:..::.            |::..||:     
  Fly   117 ----GDNMFSGGQGGNTNEIFWNIGGDDMFAFNAQAPSRKRQQDPPIEHDLFVSLEEVDK----- 172

  Fly   232 GTKCEPGTKPGRCQYCNGTGFETVSTGPF----VMRSTCR--YCQGTRQHIKYPCSECEGKGRTV 290
              .|....|..|        ..|.|.||:    |:|.|.:  :..||                  
  Fly   173 --GCIKKMKISR--------MATGSNGPYKEEKVLRITVKPGWKAGT------------------ 209

  Fly   291 QRRKVTVPVPAGIENGQTVRMQVGSKELFVTFRVERSDYFRREGADVHTDAAISLAQAVLGGTVR 355
               |:|.|     :.|.:...:..:..:|: .|.:....|:|||.|:...|.|||.||:.|..|.
  Fly   210 ---KITFP-----QEGDSAPNKTPADIVFI-IRDKPHSLFKREGIDLKYTAQISLKQALCGALVS 265

  Fly   356 VQGVYEDQWINVEPGTSSHHKIMLRGKGLKRVNAHG---------HGDHYVHVKITVP 404
            |. ..:...|.|.|    :|:| ::....:|:|..|         .||..|...|..|
  Fly   266 VP-TLQGSRIQVNP----NHEI-IKPTTTRRINGLGLPVPKEPSRRGDLIVSFDIKFP 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5504NP_995932.1 DnaJ 63..437 CDD:223560 111/382 (29%)
DnaJ 65..127 CDD:278647 33/61 (54%)
DnaJ_zf 227..287 CDD:199908 12/65 (18%)
DnaJ_C 288..409 CDD:199909 33/126 (26%)
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 111/383 (29%)
DnaJ 4..65 CDD:278647 33/61 (54%)
DnaJ_C 157..320 CDD:199909 48/209 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.