DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5504 and DNAJB13

DIOPT Version :9

Sequence 1:NP_995932.1 Gene:CG5504 / 48844 FlyBaseID:FBgn0002174 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_011543306.1 Gene:DNAJB13 / 374407 HGNCID:30718 Length:350 Species:Homo sapiens


Alignment Length:368 Identity:93/368 - (25%)
Similarity:150/368 - (40%) Gaps:98/368 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 KNANGKDIKKAYYQLAKKYHPDTNKEDPDAGRKFQEVSEAYEVLSDEQKRREYDTYGQTAENIGR 138
            :::..:|..:.|.:||.|:|| ....:|.:...|::::|||:||||..||..||.:|:.      
Human    47 EHSTAEDKDQRYRRLALKHHP-LKSNEPSSAEIFRQIAEAYDVLSDPMKRGIYDKFGEE------ 104

  Fly   139 QGGGFPGGGAGGFGPE-GFSQSWQFRSSIDPEELFRKIFGEGNFRTNSFDDFADSKFGFGQAQEM 202
               |..||....||.: .::..:.|...  ||::|.:.|| ||   |.|.:|.|       |:..
Human   105 ---GLKGGIPLEFGSQTPWTTGYVFHGK--PEKVFHEFFG-GN---NPFSEFFD-------AEGS 153

  Fly   203 VMDLTF-AQAARGVNK-------DVNVNVVDQCPKCAGTKCEPGTKPGRCQYCNGTGFE------ 253
            .:||.| ....|||.|       |:.:::.|....|  ||   ..|..| :..|..|:.      
Human   154 EVDLNFGGLQGRGVKKQDPQVERDLYLSLEDLFFGC--TK---KIKISR-RVLNEDGYSSTIKDK 212

  Fly   254 --TVSTGPFVMRSTCRYCQGTRQHIKYPCSECEG-KGRTVQRRKVTVPVPAGIENGQTVRMQVGS 315
              |:...|       .:.||||  |.:   |.|| :|..:        :||.|            
Human   213 ILTIDVKP-------GWRQGTR--ITF---EKEGDQGPNI--------IPADI------------ 245

  Fly   316 KELFVTFRVERSDYFRREGADVHTDAAISLAQAVLGGTVRVQGVYEDQWINVEPGTSSHHKIMLR 380
              :|:. :.:....||||..::.....|.|.:|:...||.|: ..:|:.:|:......|.|.   
Human   246 --IFIV-KEKLHPRFRRENDNLFFVNPIPLGKALTCCTVEVR-TLDDRLLNIPINDIIHPKY--- 303

  Fly   381 GKGLKRVNAHG---------HGDHYVHVKITVPSAKKLDKKRL 414
               .|:|...|         .||.::...|..|:.....||::
Human   304 ---FKKVPGEGMPLPEDPTKKGDLFIFFDIQFPTRLTPQKKQM 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5504NP_995932.1 DnaJ 63..437 CDD:223560 93/368 (25%)
DnaJ 65..127 CDD:278647 18/52 (35%)
DnaJ_zf 227..287 CDD:199908 17/68 (25%)
DnaJ_C 288..409 CDD:199909 25/129 (19%)
DNAJB13XP_011543306.1 DnaJ_bact 48..346 CDD:274090 93/367 (25%)
DnaJ 48..99 CDD:278647 18/51 (35%)
DnaJ_C 174..336 CDD:199909 45/209 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.