DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5504 and Dnajc16

DIOPT Version :9

Sequence 1:NP_995932.1 Gene:CG5504 / 48844 FlyBaseID:FBgn0002174 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001014216.1 Gene:Dnajc16 / 362652 RGDID:1359395 Length:771 Species:Rattus norvegicus


Alignment Length:375 Identity:94/375 - (25%)
Similarity:145/375 - (38%) Gaps:127/375 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 RDLLAKDY--YATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPDAGRKFQEVSEAYEVLSDEQ 121
            :.|.|.|:  |..|||::.|:..||||||.:||:::|||.|| ||.|..||.::|:|||:||:|:
  Rat    21 QSLSALDFDPYRVLGVSRTASQADIKKAYKKLAREWHPDKNK-DPGAEDKFIQISKAYEILSNEE 84

  Fly   122 KRREYDTYGQTAENIGRQGGGFPGGGAGGFGPEGFSQSWQFRSSIDPEELFRKIFGEGNFRTNSF 186
            ||..||.||...||                  :|:.|..::|        ||      :|..|.:
  Rat    85 KRTNYDHYGDAGEN------------------QGYQQQREYR--------FR------HFHENFY 117

  Fly   187 DDFADSKFGFGQAQEMVMD----LTFAQAARGVNKDVNVNVVDQCPKCAGTKCEPGTKPGRCQYC 247
            .|.:...|.|...:...:|    |.|:..       ||..|.|...|                  
  Rat   118 FDESFFHFPFNSERRDSIDEKYLLHFSHY-------VNEVVPDSFKK------------------ 157

  Fly   248 NGTGFETVSTGPFVMRSTCRYCQGTRQHI----KYPCSECEGKGRTV-------QRRKV------ 295
                       |::::.|..:|... .||    |....|.||.|..:       :||..      
  Rat   158 -----------PYLIKITSDWCFSC-IHIEPIWKEVVQELEGLGVGIGVVHAGYERRLAHHLGAH 210

  Fly   296 TVPVPAGIENGQTVRMQVGSKELFVTFRVERSDYFRREGADVHTDAAISLAQAVLGGTVRVQGVY 360
            :.|...||.||                   :..:|  ..|.||.:.. ...:::|.|.: |:.|.
  Rat   211 STPSILGIING-------------------KISFF--HNAVVHENLR-QFVESLLPGNL-VEKVT 252

  Fly   361 EDQWINVEPGTSSHHK--IMLRGKG-----LKRVNAHGHGDH----YVHV 399
            ...::....|....:|  .:|.|:.     |.::.|..:.|:    ||:|
  Rat   253 NKNYVRFLSGWQQENKPHALLFGQTPAAPLLYKLTAFAYKDYVSFGYVYV 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5504NP_995932.1 DnaJ 63..437 CDD:223560 93/371 (25%)
DnaJ 65..127 CDD:278647 33/63 (52%)
DnaJ_zf 227..287 CDD:199908 10/63 (16%)
DnaJ_C 288..409 CDD:199909 25/136 (18%)
Dnajc16NP_001014216.1 DnaJ 29..90 CDD:278647 32/61 (52%)
TRX_DnaJ 133..242 CDD:239261 29/167 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 559..590
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0715
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.