DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5504 and Dnajc24

DIOPT Version :10

Sequence 1:NP_995932.1 Gene:CG5504 / 48844 FlyBaseID:FBgn0002174 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001178782.1 Gene:Dnajc24 / 362184 RGDID:1564710 Length:148 Species:Rattus norvegicus


Alignment Length:82 Identity:28/82 - (34%)
Similarity:47/82 - (57%) Gaps:8/82 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 KDYYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPDAG------RKFQEVSEAYEVLSDEQK 122
            ||:|:.||...:|:..|:|:.|.:|...||||....|..||      :||.|:.:|:::|.:|:.
  Rat     9 KDWYSILGADPSADVSDLKQKYQKLILLYHPDKQSADVPAGTMEECVQKFIEIDQAWKILGNEET 73

  Fly   123 RREYDTYGQTAE--NIG 137
            :::||......|  |:|
  Rat    74 KKKYDLQRHEDELRNVG 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5504NP_995932.1 djlA <9..117 CDD:236512 21/58 (36%)
DnaJ_bact 65..424 CDD:274090 27/81 (33%)
Dnajc24NP_001178782.1 DnaJ 10..78 CDD:395170 22/67 (33%)
zf-CSL 94..147 CDD:398744
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.