DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5504 and DnaJ-H

DIOPT Version :9

Sequence 1:NP_995932.1 Gene:CG5504 / 48844 FlyBaseID:FBgn0002174 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster


Alignment Length:376 Identity:118/376 - (31%)
Similarity:169/376 - (44%) Gaps:65/376 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 YATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPDAGRKFQEVSEAYEVLSDEQKRREYDTYGQ 131
            |..|.||.:|..::|||.|.:|||::|||.|   ||||.||:|:|.|||||||.:|||.||.||.
  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKN---PDAGDKFKEISFAYEVLSDPEKRRIYDRYGL 68

  Fly   132 TAENIGRQGGGFPGGGAGGFGPEGFSQSWQFRSSIDPEELFRKIFGEGNFRTNSFDDFADSKFGF 196
            .    |.|.|.           ||||.:.:|.:...|   |.::..||..|.|            
  Fly    69 K----GLQEGA-----------EGFSDASEFFAQWFP---FDRVSSEGRGRRN------------ 103

  Fly   197 GQAQEMVMDLTFAQA-ARGVNKDVNVNVVDQCPKCAGTKCEPGTKPGR--CQYCNGTG----FET 254
            |:....| :||..:. ..|:.|.|..|....|.||.|   :.|.|...  |:.|.|.|    |..
  Fly   104 GKVVVKV-ELTLEEIYVGGMKKKVEYNRQKLCSKCNG---DGGPKEAHESCETCGGAGRAAAFTF 164

  Fly   255 VSTGPFVMRSTCRYCQGTRQHIK--YPCSECEGKGRTVQRRKVTVPVPAGIENGQTV-------R 310
            :...||  .:||..|.|....|:  ..||.|:|.|...|:.|..:.|..|..:...|       :
  Fly   165 MGLSPF--DTTCPTCDGRGFTIRDDKKCSPCQGSGFVEQKMKRDLVVERGAPHMLKVPFANEGHQ 227

  Fly   311 MQVGS-KELFVTFRVERSDYFRREGADVH-TDAAISLAQAVLGGT---VRVQGVYEDQWINVEPG 370
            |:.|. .:|.|.........|:|..|::: .|..|::.:|:.|.:   ..:.|  .:..:...||
  Fly   228 MRGGEFGDLIVVISQMEHPIFQRRHANLYMRDLEINITEALCGYSHCFKHLDG--RNVCLRTYPG 290

  Fly   371 -TSSHHKI-MLRGKGLKRVN-AHGHGDHYVHVKITVPSAKKLDKKRLALIE 418
             ...|::| |:||.|:...| |...||.|:..|:..|........:||::|
  Fly   291 EVLQHNQIKMVRGSGMPVFNKATDSGDLYMKFKVKFPDNDFATAPQLAMLE 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5504NP_995932.1 DnaJ 63..437 CDD:223560 118/376 (31%)
DnaJ 65..127 CDD:278647 34/59 (58%)
DnaJ_zf 227..287 CDD:199908 22/67 (33%)
DnaJ_C 288..409 CDD:199909 32/135 (24%)
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 118/376 (31%)
DnaJ 5..64 CDD:278647 34/59 (58%)
DnaJ_C 106..329 CDD:199909 62/230 (27%)
DnaJ_zf 134..197 CDD:199908 22/67 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440491
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.